BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_0662_orf1 (116 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|71023513|ref|XP_761986.1| hypothetical protein UM05839.1 [Ust... 37 1.4 gi|336316307|ref|ZP_08571207.1| hypothetical protein Rhein_2610 ... 34 6.9 >gi|71023513|ref|XP_761986.1| hypothetical protein UM05839.1 [Ustilago maydis 521] gi|46101551|gb|EAK86784.1| hypothetical protein UM05839.1 [Ustilago maydis 521] Length = 1434 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 6/92 (6%) Query: 21 GPVVQRSIQPRSP---YFRVQQEKMDPEAGRESSSELNRNWLSDKEPAIAAGER--EKTT 75 G + ++ PR P FR+ + + AGR+S L + +E A+ A ER + Sbjct: 1075 GSTREATVTPRQPATYVFRISKRGLADAAGRDSRMRLTVEYRGLQEDAVCAAERALDALV 1134 Query: 76 GAFPQLYGVHLRNPSEPLHLD-LSIYVHQRAD 106 A L G+ P+ L D L +YV +R D Sbjct: 1135 EADAALEGLKTGTPTRRLLQDALVVYVRERLD 1166 >gi|336316307|ref|ZP_08571207.1| hypothetical protein Rhein_2610 [Rheinheimera sp. A13L] gi|335879429|gb|EGM77328.1| hypothetical protein Rhein_2610 [Rheinheimera sp. A13L] Length = 241 Score = 34.3 bits (77), Expect = 6.9, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Query: 40 EKMDPEAGRESSSELNRNWLSDKEPAIAAGEREKTTGAFPQLYGVHLRNPSEPLHLDLSI 99 + +D E E ++ WL +PAI E GA P L GVH + + L +L++ Sbjct: 161 QTLDAEWEGEFRAQYRYRWLPAVQPAIELYAGENYKGAGPSLMGVHKFDKQKQLKWELAV 220 Query: 100 YVHQRADNSTTVR 112 V DN T R Sbjct: 221 IVA--IDNDTVDR 231 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.315 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,222,826,363 Number of extensions: 45066497 Number of successful extensions: 92115 Number of sequences better than 10.0: 5 Number of HSP's gapped: 92816 Number of HSP's successfully gapped: 5 Length of query: 116 Length of database: 5,058,227,080 Length adjustment: 83 Effective length of query: 33 Effective length of database: 3,831,675,324 Effective search space: 126445285692 Effective search space used: 126445285692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 76 (33.9 bits)