BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_0469_orf2 (200 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|259145030|emb|CAY78295.1| Cdc39p [Saccharomyces cerevisiae EC... 39 0.55 gi|256270168|gb|EEU05392.1| Cdc39p [Saccharomyces cerevisiae JAY... 39 0.55 gi|207347218|gb|EDZ73470.1| YCR093Wp-like protein [Saccharomyces... 39 0.55 gi|190406509|gb|EDV09776.1| general negative regulator of transc... 39 0.55 gi|151943903|gb|EDN62203.1| CCR4-NOT transcriptional complex sub... 39 0.55 gi|287911|emb|CAA49721.1| CDC39 [Saccharomyces cerevisiae] 39 0.55 gi|10383811|ref|NP_010017.2| Cdc39p [Saccharomyces cerevisiae S2... 39 0.55 gi|254386752|ref|ZP_05002044.1| DNA polymerase III subunit epsil... 35 4.5 >gi|259145030|emb|CAY78295.1| Cdc39p [Saccharomyces cerevisiae EC1118] Length = 2108 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|256270168|gb|EEU05392.1| Cdc39p [Saccharomyces cerevisiae JAY291] Length = 2109 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|207347218|gb|EDZ73470.1| YCR093Wp-like protein [Saccharomyces cerevisiae AWRI1631] Length = 1518 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 152 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 192 >gi|190406509|gb|EDV09776.1| general negative regulator of transcription subunit 1 [Saccharomyces cerevisiae RM11-1a] Length = 2108 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|151943903|gb|EDN62203.1| CCR4-NOT transcriptional complex subunit [Saccharomyces cerevisiae YJM789] Length = 2108 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|287911|emb|CAA49721.1| CDC39 [Saccharomyces cerevisiae] Length = 2108 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|10383811|ref|NP_010017.2| Cdc39p [Saccharomyces cerevisiae S288c] gi|308153578|sp|P25655.3|NOT1_YEAST RecName: Full=General negative regulator of transcription subunit 1; AltName: Full=Cell division cycle protein 39 gi|14588961|emb|CAA42248.2| nuclear protein [Saccharomyces cerevisiae] gi|285810778|tpg|DAA07562.1| TPA: Cdc39p [Saccharomyces cerevisiae S288c] Length = 2108 Score = 38.5 bits (88), Expect = 0.55, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%) Query: 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct: 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 >gi|254386752|ref|ZP_05002044.1| DNA polymerase III subunit epsilon [Streptomyces sp. Mg1] gi|194345589|gb|EDX26555.1| DNA polymerase III subunit epsilon [Streptomyces sp. Mg1] Length = 246 Score = 35.4 bits (80), Expect = 4.5, Method: Compositional matrix adjust. Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 10/85 (11%) Query: 107 PGISTPEAAAVVAGNSTSRAAAQRVGPLCCRLLQHVCTQVKATLLLHVQHQQLRPEAEVF 166 PGI PE A+ + G ST+RA A+ R ++ V +V A L+ H + R V Sbjct: 49 PGIPIPEQASAIHGISTARAVAE------GRPVREVAQEVAAALVEHWR----RGAVVVA 98 Query: 167 PDTAFAMDEVACLLAQDGAPNGSDN 191 + AF + ++ LA+ G P+ SD Sbjct: 99 YNAAFDLTLLSAELARHGLPSLSDR 123 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.322 0.131 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,490,314,305 Number of extensions: 44279877 Number of successful extensions: 78033 Number of sequences better than 10.0: 8 Number of HSP's gapped: 78229 Number of HSP's successfully gapped: 8 Length of query: 200 Length of database: 5,058,227,080 Length adjustment: 132 Effective length of query: 68 Effective length of database: 3,107,566,456 Effective search space: 211314519008 Effective search space used: 211314519008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 78 (34.7 bits)