BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eten_0469_orf1 (133 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|291302833|ref|YP_003514111.1| ArsR family transcriptional reg... 35 3.5 gi|308495262|ref|XP_003109819.1| CRE-PQN-87 protein [Caenorhabdi... 34 6.8 >gi|291302833|ref|YP_003514111.1| ArsR family transcriptional regulator [Stackebrandtia nassauensis DSM 44728] gi|290572053|gb|ADD45018.1| transcriptional regulator, ArsR family [Stackebrandtia nassauensis DSM 44728] Length = 355 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 26/56 (46%) Query: 57 DRQRATSRAGCSIGCSTGHQYSRSSSCCGWKQHKQSSSAARGTSLLQTAAACLHPG 112 +RQR ++ GC++G T HQY S G+ + +A G + + PG Sbjct: 300 ERQRVEAQIGCAVGTLTTHQYRDMLSAIGFGDIDITLTADHGAGIHSAIVQAIKPG 355 >gi|308495262|ref|XP_003109819.1| CRE-PQN-87 protein [Caenorhabditis remanei] gi|308244656|gb|EFO88608.1| CRE-PQN-87 protein [Caenorhabditis remanei] Length = 1518 Score = 34.3 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 58 RQRATSRAGCSIGCSTGHQYSRSSSCCGWKQHKQSSSAARGTSLLQTAAA 107 +++A +R GC +GC T + + S+S +QH QSS + + QTA Sbjct: 10 KKKARTRIGCDVGCQT--EQTSSASISYVQQHNQSSQPSSNATSQQTAGG 57 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.317 0.127 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 839,447,925 Number of extensions: 18888300 Number of successful extensions: 43556 Number of sequences better than 10.0: 4 Number of HSP's gapped: 43811 Number of HSP's successfully gapped: 4 Length of query: 133 Length of database: 5,058,227,080 Length adjustment: 98 Effective length of query: 35 Effective length of database: 3,610,009,344 Effective search space: 126350327040 Effective search space used: 126350327040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)