BLASTP 2.2.24 [Aug-08-2010] Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= Eace_0015_orf1 (133 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 14,777,732 sequences; 5,058,227,080 total letters
Score E Sequences producing significant alignments: (bits) Value gi|229828178|ref|ZP_04454247.1| hypothetical protein GCWU000342_... 39 0.27 gi|326331763|ref|ZP_08198051.1| phosphonate ABC transporter, ATP... 35 2.4 gi|339620143|gb|EGQ24714.1| 4-diphosphocytidyl-2-C-methyl-D-eryt... 35 2.7 gi|240169601|ref|ZP_04748260.1| multi-functional membrane-associ... 35 5.0 >gi|229828178|ref|ZP_04454247.1| hypothetical protein GCWU000342_00235 [Shuttleworthia satelles DSM 14600] gi|229792772|gb|EEP28886.1| hypothetical protein GCWU000342_00235 [Shuttleworthia satelles DSM 14600] Length = 250 Score = 38.9 bits (89), Expect = 0.27, Method: Compositional matrix adjust. Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 3/93 (3%) Query: 36 RGKVMQSVSGGGREPSLTIKCESP-ELAL--ITKPNSAARPTMPASQIGMLFSTTFLTPR 92 RG+ MQ S GG+E +L E P +L L IT P+ + A + FLT Sbjct: 41 RGQEMQVTSAGGQEEALQKLQERPYDLVLLDITLPDGSGYSVCNAVKRDYQTPVIFLTAS 100 Query: 93 RSMNGSVSASSIASTKFSCKPLAPRNSIVQVRS 125 N V+ + + + KP PR + ++R+ Sbjct: 101 GDENSVVTGFDLGAEDYIAKPFRPRELVSRIRN 133 >gi|326331763|ref|ZP_08198051.1| phosphonate ABC transporter, ATP-binding protein [Nocardioidaceae bacterium Broad-1] gi|325950562|gb|EGD42614.1| phosphonate ABC transporter, ATP-binding protein [Nocardioidaceae bacterium Broad-1] Length = 265 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 4/78 (5%) Query: 37 GKVMQSVSGGGREPSLTIKC----ESPELALITKPNSAARPTMPASQIGMLFSTTFLTPR 92 G+V+ + G S +++C E P+ IT ARP + M+F L PR Sbjct: 37 GEVVSLLGANGSGKSTSLRCVVGLERPDAGTITVDGVTARPAEAMPTVAMVFQKIHLVPR 96 Query: 93 RSMNGSVSASSIASTKFS 110 RS+ +V A ++ S Sbjct: 97 RSVLDNVCAGALGRLGLS 114 >gi|339620143|gb|EGQ24714.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase [Sporosarcina newyorkensis 2681] Length = 226 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 32/107 (29%), Positives = 45/107 (42%), Gaps = 24/107 (22%) Query: 4 RANSRTSRYLPSIGAL----WRPSKFLRTPYC-------------------ARNDRGKVM 40 R + ++ IG L S FL P+C AR+D+GK + Sbjct: 15 RMGAGQNKLFLEIGGLPILYHTVSIFLEDPHCEEIIIAVKPEEQTVIKEMLARSDKGKTI 74 Query: 41 QSVSGGG-REPSLTIKCESPELALITKPNSAARPTMPASQIGMLFST 86 V GGG R+ S+ E+ E I + AARP + +S I L ST Sbjct: 75 TFVKGGGERQNSVAACIETYEGNGIVLVHDAARPFLDSSVIRKLVST 121 >gi|240169601|ref|ZP_04748260.1| multi-functional membrane-associated mycocerosic acid synthase mas [Mycobacterium kansasii ATCC 12478] Length = 2101 Score = 34.7 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Query: 1 TIIRANSRTSRYLPSIGALWRPSKFLRTPYCARNDRGKVMQSVSGGGREPS 51 T++R + + Y+P IGA W P R+P+ G++ QS G R PS Sbjct: 1960 TLLRYDRAYTGYIPIIGAPWLPDLVRRSPW------GEMFQSAGQGSRGPS 2004 Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects Posted date: Jul 22, 2011 4:42 PM Number of letters in database: 5,058,227,080 Number of sequences in database: 14,777,732 Lambda K H 0.317 0.128 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 14777732 Number of Hits to DB: 1,209,137,596 Number of extensions: 43624635 Number of successful extensions: 100288 Number of sequences better than 10.0: 18 Number of HSP's gapped: 101550 Number of HSP's successfully gapped: 18 Length of query: 133 Length of database: 5,058,227,080 Length adjustment: 98 Effective length of query: 35 Effective length of database: 3,610,009,344 Effective search space: 126350327040 Effective search space used: 126350327040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 76 (33.9 bits)