bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-9_CDS_annotation_glimmer3.pl_2_7 Length=157 Score E Sequences producing significant alignments: (Bits) Value bmd:BMD_1109 asparagine synthetase (EC:6.3.5.4) 36.6 1.4 pfc:PflA506_2690 membrane protein 35.4 3.9 nmu:Nmul_A1213 HhH-GPD 34.3 8.7 > bmd:BMD_1109 asparagine synthetase (EC:6.3.5.4) Length=248 Score = 36.6 bits (83), Expect = 1.4, Method: Compositional matrix adjust. Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 53 KSIIGYVPRYIAYKTDIDCVDGAFLTSLTSWVTPLTI 89 KSI+ ++ RY A + C D FL S T W+TP ++ Sbjct 20 KSILKHLQRYYADSSSFWCKDSVFLGSHTRWITPESV 56 > pfc:PflA506_2690 membrane protein Length=540 Score = 35.4 bits (80), Expect = 3.9, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Query 77 LTSLTSWVTPLTIDEIVTKISLGSGTGPFTPNYGLFKVSPYVLDSIFVSQCDSTVDTDQF 136 +TSLT+W+ P + + + + T P++P +GL ++ +L S F+S+ + V DQ Sbjct 88 VTSLTAWL-PTAVASALIVVLVYRLTAPYSPRWGLLSIAMLLLSSTFISETRA-VSLDQM 145 Query 137 L 137 L Sbjct 146 L 146 > nmu:Nmul_A1213 HhH-GPD Length=297 Score = 34.3 bits (77), Expect = 8.7, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 20/34 (59%), Gaps = 0/34 (0%) Query 80 LTSWVTPLTIDEIVTKISLGSGTGPFTPNYGLFK 113 L +WV L +D I K+ G GP+T NYGL + Sbjct 204 LDAWVETLPVDVIREKLEAVRGIGPWTVNYGLLR 237 Lambda K H a alpha 0.319 0.139 0.416 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126285309131