bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-6_CDS_annotation_glimmer3.pl_2_2 Length=107 Score E Sequences producing significant alignments: (Bits) Value tap:GZ22_04925 penicillin-binding protein 35.8 0.94 xce:Xcel_1166 amidohydrolase 35.4 1.1 enr:H650_20620 nucleotide-binding protein 33.5 4.0 swi:Swit_0475 5-oxoprolinase (EC:3.5.2.9) 33.5 5.3 > tap:GZ22_04925 penicillin-binding protein Length=727 Score = 35.8 bits (81), Expect = 0.94, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Query 30 GLTPQQVAE----MAKRGIPVSPMNVNFI-DVNGDASWNIEPQFRRDMDMATAWEMEKAS 84 GLTP ++AE A G + ++N I D NG+A++ EPQ TAW+M + Sbjct 467 GLTPLKIAEGFRTFAHEGQWIESQSINAIYDRNGEAAFKAEPQTEDVFSEQTAWDMTRML 526 Query 85 Q 85 Q Sbjct 527 Q 527 > xce:Xcel_1166 amidohydrolase Length=373 Score = 35.4 bits (80), Expect = 1.1, Method: Composition-based stats. Identities = 19/55 (35%), Positives = 27/55 (49%), Gaps = 2/55 (4%) Query 30 GLTPQQVAEMAKRGIPVSP--MNVNFIDVNGDASWNIEPQFRRDMDMATAWEMEK 82 G+TP Q E+A RG+PV+P + V V D + P F R + A E+ Sbjct 216 GVTPDQAVELAARGVPVTPTLLQVERFGVIADQAQERYPAFARRLRAMHARRYEQ 270 > enr:H650_20620 nucleotide-binding protein Length=163 Score = 33.5 bits (75), Expect = 4.0, Method: Compositional matrix adjust. Identities = 25/96 (26%), Positives = 51/96 (53%), Gaps = 9/96 (9%) Query 4 NTKPDYKCVECNFDVQKDFERTKPNLGLTPQQV--------AEMAKRGIPVSPMNVNFID 55 T+ D++ VE F++ ++ ++T L + QV A++ KRGI + ++V Sbjct 27 GTRFDFRNVEATFELNEE-KQTIKVLSESDFQVNQLLDILRAKLLKRGIEGASLDVPEEF 85 Query 56 VNGDASWNIEPQFRRDMDMATAWEMEKASQRKALQV 91 V+ +W +E + ++ +D ATA ++ K + L+V Sbjct 86 VHSGKTWFVEAKLKQGIDAATAKKIIKLIKDSKLKV 121 > swi:Swit_0475 5-oxoprolinase (EC:3.5.2.9) Length=680 Score = 33.5 bits (75), Expect = 5.3, Method: Composition-based stats. Identities = 21/74 (28%), Positives = 39/74 (53%), Gaps = 7/74 (9%) Query 31 LTPQQVAEMAKRGIPVSPMNVNFI----DVNGDASWNIEPQFRRDM-DMATAWEMEK--A 83 L PQ+ + RGI +S +N++F+ + DASW +M D ATAW + + A Sbjct 468 LVPQEPGTLCARGILLSDINMDFVRSELSLAADASWRRVCAVLGEMRDEATAWLVREGVA 527 Query 84 SQRKALQVLRQKKF 97 + + L+++ ++ Sbjct 528 EEDRQLRIMVDARY 541 Lambda K H a alpha 0.317 0.131 0.398 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125230604613