bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-6_CDS_annotation_glimmer3.pl_2_1 Length=59 Score E Sequences producing significant alignments: (Bits) Value mgp:100540533 leucine-rich repeat transmembrane neuronal prote... 33.9 1.8 sdl:Sdel_1837 3-oxoacyl-ACP reductase 31.6 7.2 smul:SMUL_2528 3-oxoacyl-[acyl-carrier protein] reductase (EC:... 31.6 8.0 > mgp:100540533 leucine-rich repeat transmembrane neuronal protein 1-like Length=521 Score = 33.9 bits (76), Expect = 1.8, Method: Composition-based stats. Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%) Query 18 VDPNAVNQVFSVTEYTDKIFGYVKFNATARLP 49 VDP +VN + VT +D++FGY ATA +P Sbjct 367 VDPTSVNTLSPVTNNSDQMFGYGSAAATAYVP 398 > sdl:Sdel_1837 3-oxoacyl-ACP reductase Length=247 Score = 31.6 bits (70), Expect = 7.2, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 21 NAVNQVFSVTEYTDKIFGYVKFNATARLPISRVAIPR 57 N+V F TE TDK+ +K + T+++P+ R P+ Sbjct 181 NSVTPGFIATEMTDKLSAEIKESYTSKIPLKRFGTPK 217 > smul:SMUL_2528 3-oxoacyl-[acyl-carrier protein] reductase (EC:1.1.1.100) Length=247 Score = 31.6 bits (70), Expect = 8.0, Method: Composition-based stats. Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 21 NAVNQVFSVTEYTDKIFGYVKFNATARLPISRVAIPR 57 NAV F TE TDK+ +K + T+++P+ R P+ Sbjct 181 NAVTPGFIATEMTDKLSDEIKESYTSKIPLKRFGSPK 217 Lambda K H a alpha 0.326 0.140 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125989489341