bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-41_CDS_annotation_glimmer3.pl_2_1 Length=195 Score E Sequences producing significant alignments: (Bits) Value ota:Ot15g02690 Chromosome condensation complex Condensin, subu... 37.4 1.4 csl:COCSUDRAFT_57535 hypothetical protein 37.7 1.5 > ota:Ot15g02690 Chromosome condensation complex Condensin, subunit G (ISS) Length=304 Score = 37.4 bits (85), Expect = 1.4, Method: Compositional matrix adjust. Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 0/76 (0%) Query 96 LTSFHKGVFTQSYWVQRANQRLKNFLPLETSKHLQQIMLLTKKVSDALFPCQMRITLNCP 155 L+ G +Q + Q L E +K +++ +L + +SD PC + T + Sbjct 168 LSRLQDGGESQDFSQDEITQAFVELLGSEKNKEVRKAILGSLAISDCTVPCVIERTRDVA 227 Query 156 LDLQALPFLMLTQLLP 171 D++ + FL LT +P Sbjct 228 EDVRRIAFLALTSKVP 243 > csl:COCSUDRAFT_57535 hypothetical protein Length=1330 Score = 37.7 bits (86), Expect = 1.5, Method: Composition-based stats. Identities = 35/124 (28%), Positives = 59/124 (48%), Gaps = 17/124 (14%) Query 80 NTFLSILHNILISLEC-LTSFHKGVFTQ-SYWVQRANQRLK---------NFLPLETSKH 128 NT L L N L+ ++ TS +G+ + W+Q L+ +FL LE ++ Sbjct 16 NTLLPALENCLLEVDAACTSGRQGISDNGNTWLQACTALLEHGAVLAQASSFLQLEVTQL 75 Query 129 LQQIMLLTKKVSDALFPCQMRITLNCPLDLQ----ALPFLMLTQLLPYFVRWYSAPADSS 184 LQ+ + ++++AL Q+R+ L P+ LQ A+P +Q L ++W S Sbjct 76 LQRHLEKRPRLAEALLCTQLRVFLQHPVALQQLLRAVPSNQTSQSLA--MQWPSPACKGQ 133 Query 185 ARQV 188 A QV Sbjct 134 ALQV 137 Lambda K H a alpha 0.328 0.136 0.415 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 204260545629