bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-36_CDS_annotation_glimmer3.pl_2_2 Length=71 Score E Sequences producing significant alignments: (Bits) Value ccq:N149_1082 Acetolactate synthase large subunit (EC:2.2.1.6) 33.9 2.1 ccc:G157_03230 acetolactate synthase large subunit 33.9 2.1 > ccq:N149_1082 Acetolactate synthase large subunit (EC:2.2.1.6) Length=585 Score = 33.9 bits (76), Expect = 2.1, Method: Composition-based stats. Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%) Query 7 IDISNQHAKFNFDQAKNWDSTERFTNVATTWINSISCAVGQFTGSASDLKQA 58 I ++ Q ++F+FDQAK++ T+ + N+ +I S + ++ Q AS + +A Sbjct 164 IPMNIQRSEFDFDQAKSFFKTKEYLNMQNYYITSNNLSIKQIKHIASKISKA 215 > ccc:G157_03230 acetolactate synthase large subunit Length=585 Score = 33.9 bits (76), Expect = 2.1, Method: Composition-based stats. Identities = 16/52 (31%), Positives = 32/52 (62%), Gaps = 0/52 (0%) Query 7 IDISNQHAKFNFDQAKNWDSTERFTNVATTWINSISCAVGQFTGSASDLKQA 58 I ++ Q ++F+FDQAK++ T+ + N+ +I S + ++ Q AS + +A Sbjct 164 IPMNIQRSEFDFDQAKSFFKTKEYLNMQNYYITSNNLSIKQIKHIASKISKA 215 Lambda K H a alpha 0.317 0.129 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126269703504