bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-2_CDS_annotation_glimmer3.pl_2_3 Length=73 Score E Sequences producing significant alignments: (Bits) Value alt:ambt_14960 hypothetical protein 33.5 2.9 zro:ZYRO0F12804g hypothetical protein 32.7 5.0 csu:CSUB_C0037 hypothetical protein 32.0 8.4 > alt:ambt_14960 hypothetical protein Length=568 Score = 33.5 bits (75), Expect = 2.9, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Query 19 KLIATFVIGVITTLFVHSCTLSLSVAKNNTNSTQKTEQT----STSSVDSTRINI 69 K +T + V T+LF+ +C+ + A + N+T+K QT ST V+ +R++I Sbjct 6 KHYSTLAVAVATSLFMSACSKAPEEAVSQANTTEKASQTVLPDSTLLVNESRLSI 60 > zro:ZYRO0F12804g hypothetical protein Length=399 Score = 32.7 bits (73), Expect = 5.0, Method: Compositional matrix adjust. Identities = 15/41 (37%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 2 SKKTIMKITATQWIEIVKLIATFVIGVITTLFVHSCTLSLS 42 +K+T+ I QW+EI+KL+ V+ + +T +H+ LS S Sbjct 54 NKRTLRDIPLDQWVEILKLVKCEVLSIKSTKQMHAFLLSES 94 > csu:CSUB_C0037 hypothetical protein Length=486 Score = 32.0 bits (71), Expect = 8.4, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 2/57 (4%) Query 17 IVKLIATFVIGVI-TTLFVHSCTLSLSVAKNNTNSTQKTEQTSTSSVDSTRININSK 72 ++ +I+ V+GV+ TT F+H T ++ K T T QT+ S TR+N+ +K Sbjct 7 LILVISLLVVGVLATTTFLHPSTHQITSVKPGETDTHTTVQTAMSP-SMTRLNLIAK 62 Lambda K H a alpha 0.313 0.121 0.317 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125472237464