bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-25_CDS_annotation_glimmer3.pl_2_3 Length=56 Score E Sequences producing significant alignments: (Bits) Value tvi:Thivi_0844 anthranilate phosphoribosyltransferase 32.3 4.6 shs:STEHIDRAFT_117967 hypothetical protein 32.0 6.7 > tvi:Thivi_0844 anthranilate phosphoribosyltransferase Length=373 Score = 32.3 bits (72), Expect = 4.6, Method: Composition-based stats. Identities = 16/41 (39%), Positives = 24/41 (59%), Gaps = 0/41 (0%) Query 15 IAAAIGAAAAVILEQGCTHKHILKANGIKIDTIKVETSTRI 55 +AA A AV + G TH+H+L+A G +D VE + R+ Sbjct 121 VAAISQGAHAVGPKFGVTHRHVLEAAGAPVDLTPVEAADRL 161 > shs:STEHIDRAFT_117967 hypothetical protein Length=628 Score = 32.0 bits (71), Expect = 6.7, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 5 VKKIVKWIAVIAAAIGAAAAVILEQGCTHKHILKANGIKID 45 VK +++ A +A IG + + L +GC+++ ++ N IK++ Sbjct 26 VKTVMRRAACLALVIGTLSYLFLSKGCSYRGLIHTNSIKLE 66 Lambda K H a alpha 0.320 0.131 0.362 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127142967006