bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-23_CDS_annotation_glimmer3.pl_2_8 Length=82 Score E Sequences producing significant alignments: (Bits) Value mml:MLC_6270 dnaC; Replicative DNA helicase DnaC 34.3 2.0 mst:Msp_1084 cdcH; CdcH 32.3 9.5 ava:Ava_C0200 hypothetical protein 32.3 9.7 > mml:MLC_6270 dnaC; Replicative DNA helicase DnaC Length=437 Score = 34.3 bits (77), Expect = 2.0, Method: Compositional matrix adjust. Identities = 17/49 (35%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 26 HLATEEKFKSEKAAQMQINKTNWDLVSALVYALKEADEWAEKNPELINQ 74 +LA FK K A + +N L++ L+ + + D A KNP++INQ Sbjct 215 NLALNAAFKEHKVALFSLEMSNEQLIARLLSRISKVDSLAFKNPKIINQ 263 > mst:Msp_1084 cdcH; CdcH Length=730 Score = 32.3 bits (72), Expect = 9.5, Method: Compositional matrix adjust. Identities = 18/33 (55%), Positives = 19/33 (58%), Gaps = 3/33 (9%) Query 41 MQINKTNWDLVSALVYA---LKEADEWAEKNPE 70 +QI NWD V L A LKEA EW KNPE Sbjct 468 VQIPDVNWDDVGGLDDAKQELKEAIEWPLKNPE 500 > ava:Ava_C0200 hypothetical protein Length=733 Score = 32.3 bits (72), Expect = 9.7, Method: Composition-based stats. Identities = 23/77 (30%), Positives = 40/77 (52%), Gaps = 15/77 (19%) Query 1 MANLKEAFKIRLLPESE------EYVITIGSHLATEEKFKSEKAAQMQ--INKTNWDLVS 52 + LK K+RL+ ++ +Y + G L+T+E+ + E+ A+MQ ++ N L++ Sbjct 647 IQELKRVTKLRLMALTQAKAKVRQYCVITGHILSTQERDRLEQRAKMQFYLDSGNETLIA 706 Query 53 ALVYALKEADEWAEKNP 69 EA EWA NP Sbjct 707 -------EAKEWATANP 716 Lambda K H a alpha 0.307 0.123 0.334 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126649600922