bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_4 Length=58 Score E Sequences producing significant alignments: (Bits) Value tae:TepiRe1_0567 fumA; Hydro-lyase, Fe-S type, tartrate/fumara... 33.1 2.2 tep:TepRe1_0517 Fe-S type, tartrate/fumarate subfamily hydro-l... 33.1 2.2 > tae:TepiRe1_0567 fumA; Hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha subunit (EC:4.2.1.2) Length=281 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 9 MKKICYELDEDVITKKYSFTKQERRLICEKTFDKDEQNAKIWKQRQLKL 57 +KK CYELD++ I K E I +KT +NAK K++Q+ + Sbjct 18 VKKACYELDDNFIGALEEALKHEESPIGKKTISLLLENAKYAKEQQIAV 66 > tep:TepRe1_0517 Fe-S type, tartrate/fumarate subfamily hydro-lyase subunit alpha (EC:4.2.1.2) Length=281 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 0/49 (0%) Query 9 MKKICYELDEDVITKKYSFTKQERRLICEKTFDKDEQNAKIWKQRQLKL 57 +KK CYELD++ I K E I +KT +NAK K++Q+ + Sbjct 18 VKKACYELDDNFIGALEEALKHEESPIGKKTISLLLENAKYAKEQQIAV 66 Lambda K H a alpha 0.321 0.135 0.420 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126373981896