bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_4 Length=91 Score E Sequences producing significant alignments: (Bits) Value fnu:FN1484 hypothetical protein 33.5 3.5 mdm:103440342 protein NRT1/ PTR FAMILY 8.1-like 33.1 5.3 fnc:HMPREF0946_01174 hypothetical protein 32.3 8.5 mdm:103428617 protein NRT1/ PTR FAMILY 8.2-like 32.3 9.4 > fnu:FN1484 hypothetical protein Length=245 Score = 33.5 bits (75), Expect = 3.5, Method: Compositional matrix adjust. Identities = 14/36 (39%), Positives = 22/36 (61%), Gaps = 0/36 (0%) Query 24 IIKIMQKFIISVKEKQTGRDVIPPYIVNSLEGLGHY 59 I+KI F+I +KE + D++ YIVN+ + L Y Sbjct 183 IVKIYANFLIDIKEYRKAEDILMKYIVNNEDNLDEY 218 > mdm:103440342 protein NRT1/ PTR FAMILY 8.1-like Length=663 Score = 33.1 bits (74), Expect = 5.3, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query 8 IPLRRIEVTAIINALKIIKIMQKFIISVKEKQTGRDVIPPYIVNSLEGLG 57 IP + V A INAL +I + +KFI+ + K+TG P + SL+ +G Sbjct 465 IPPGSVPVFAAINALILIPLYEKFIVPIIRKRTGH----PRGLTSLQRMG 510 > fnc:HMPREF0946_01174 hypothetical protein Length=265 Score = 32.3 bits (72), Expect = 8.5, Method: Compositional matrix adjust. Identities = 14/36 (39%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 24 IIKIMQKFIISVKEKQTGRDVIPPYIVNSLEGLGHY 59 I+KI F+I +KE + D++ YIVN+ L Y Sbjct 203 IVKIYANFLIEIKEYRKAEDILMKYIVNNENNLDEY 238 > mdm:103428617 protein NRT1/ PTR FAMILY 8.2-like Length=325 Score = 32.3 bits (72), Expect = 9.4, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Query 8 IPLRRIEVTAIINALKIIKIMQKFIISVKEKQTGRDVIPPYIVNSLEGLG 57 IP + V A INAL +I + +KFI+ + K+TG P + SL+ +G Sbjct 127 IPPGSVPVFAAINALILIPLYEKFIVPIIRKRTGH----PRGLTSLQRMG 172 Lambda K H a alpha 0.319 0.140 0.368 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127599116940