bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-11_CDS_annotation_glimmer3.pl_2_3 Length=72 Score E Sequences producing significant alignments: (Bits) Value sve:SVEN_1591 metallo-beta-lactamase superfamily protein 32.0 7.5 > sve:SVEN_1591 metallo-beta-lactamase superfamily protein Length=188 Score = 32.0 bits (71), Expect = 7.5, Method: Compositional matrix adjust. Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 4/41 (10%) Query 26 NTYKIAEKFAIMLNDTEETKVVCVI--ESWKLYPNENEKKT 64 NT+K AE FA +++D ETK+ V+ ESW +YP + T Sbjct 134 NTWKDAEAFASLIHDV-ETKLFAVLPDESW-IYPGHGKDTT 172 Lambda K H a alpha 0.310 0.127 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125870970484