bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-5_CDS_annotation_glimmer3.pl_2_4 Length=67 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01606 47.8 5e-06 > 469590.BSCG_01606 Length=69 Score = 47.8 bits (112), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 26/69 (38%), Positives = 41/69 (59%), Gaps = 2/69 (3%) Query 1 MKITPQQWIEVVKLISTFIIGLITALCIHSC--TASMSVFWKNSNSNQESQQTTRQSVDS 58 MK+T QW +++ I T ++ + + + SC T SMSV NS+S Q+ +Q + DS Sbjct 1 MKLTSDQWNRIIQAIVTAVVTICNIILVSSCAVTMSMSVQKNNSSSTQQIEQKSESRNDS 60 Query 59 TRIDVQPNF 67 T +D+ PNF Sbjct 61 TTLDLSPNF 69 Lambda K H a alpha 0.319 0.126 0.376 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126908645360