bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-35_CDS_annotation_glimmer3.pl_2_1 Length=96 Score E Sequences producing significant alignments: (Bits) Value 575593.HMPREF0491_02950 35.8 0.85 > 575593.HMPREF0491_02950 Length=2532 Score = 35.8 bits (81), Expect = 0.85, Method: Compositional matrix adjust. Identities = 24/81 (30%), Positives = 43/81 (53%), Gaps = 6/81 (7%) Query 4 ESWSQSDWYNAAQSWNQMLSSTGMTPLGLQETLSDIGKNAGNAIDNAIGAGRKAGEKLRG 63 E+ SQS++ A +S + + + TLSD+G +GN ++ ++G GR G Sbjct 1676 ENLSQSEYEAAKESTLTAFYTPKVVIDAIYHTLSDMGFESGNILEPSMGTGR-----FIG 1730 Query 64 NMNKAMDNIK-NGHGIDNITG 83 N+ ++M K G +D+I+G Sbjct 1731 NLPESMQKSKFYGIELDSISG 1751 Lambda K H a alpha 0.310 0.129 0.384 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 128516323040