bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-31_CDS_annotation_glimmer3.pl_2_4 Length=259 Score E Sequences producing significant alignments: (Bits) Value 272564.Dhaf_4807 39.7 0.58 > 272564.Dhaf_4807 Length=694 Score = 39.7 bits (91), Expect = 0.58, Method: Compositional matrix adjust. Identities = 30/91 (33%), Positives = 42/91 (46%), Gaps = 16/91 (18%) Query 11 GGAIGGLFGDAIGGTITGATLGSHLGS------IGSALGTGMGLVGSAKGLYDSFNNTSL 64 G G +F +A+ G I+GA +GS +G +G A G G+GL+ N T+ Sbjct 162 GSDAGTMFQNALSGVISGAAIGSAVGPPVIGTVVGIAAGLGLGLI----------NGTTS 211 Query 65 KNQMAYDQFKSELDYQYWSRKMSNRHTLEVG 95 N D FK + QY + K S TL G Sbjct 212 INNKKDDAFKDYVQEQYNTIKQSQEDTLAHG 242 Lambda K H a alpha 0.313 0.128 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 380011600830