bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-23_CDS_annotation_glimmer3.pl_2_6 Length=144 Score E Sequences producing significant alignments: (Bits) Value 203124.Tery_4471 34.3 8.2 > 203124.Tery_4471 Length=991 Score = 34.3 bits (77), Expect = 8.2, Method: Compositional matrix adjust. Identities = 32/111 (29%), Positives = 47/111 (42%), Gaps = 39/111 (35%) Query 17 FHMSIKELPAECTYKIAVTIAKAIVPKD--------ERIIAVVESWKLYPNEN----EKT 64 F + I E + T K A ++++++ KD ++II ++ES KL PN N T Sbjct 415 FAIIIDEAHSSQTGKSAASMSESLSKKDSEVEETTEDKIIRIIESQKLCPNANYYAFTAT 474 Query 65 EKNKKYEV------------------------DGFIFNTLQEVKHYVWYQT 91 KNK E+ +GFI N LQ HY Y+T Sbjct 475 PKNKTLELFGVKNPEDGKFYPFHSYSMKQAIEEGFILNVLQ---HYTTYKT 522 Lambda K H a alpha 0.316 0.132 0.389 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126217441800