bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_1 Length=77 Score E Sequences producing significant alignments: (Bits) Value 369723.Strop_4037 33.5 2.6 > 369723.Strop_4037 Length=253 Score = 33.5 bits (75), Expect = 2.6, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query 4 ATSASPSSSGVIVTVLPYWFCFTINFILSSFIPVVTIFMVDV 45 A A+ SGV++ VLP CF FIL+ +PV+ + DV Sbjct 212 AAEATAQRSGVLI-VLPLGLCFLPAFILAGLVPVIVAVLGDV 252 Lambda K H a alpha 0.330 0.141 0.448 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127558583650