bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_6 Length=164 Score E Sequences producing significant alignments: (Bits) Value 484018.BACPLE_00803 52.4 1e-06 > 484018.BACPLE_00803 Length=140 Score = 52.4 bits (124), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 1/72 (1%) Query 51 VRYTSDVCLILHTKDLASRAGLAVASKFGQSKQPISQIQQIMDTMSDEDLLATIRSRYIQ 110 V Y +D+ +IL+ + L S LA S + + SQ+ Q+ + MSDE L ++SRYIQ Sbjct 31 VTYRNDIYMILNQRRLDS-MTLAQFSDYLDHDRSASQLSQMREKMSDEQLHQFVKSRYIQ 89 Query 111 SPSEIIAWSKEL 122 PSE+ AW+ L Sbjct 90 HPSELRAWASYL 101 Lambda K H a alpha 0.309 0.123 0.327 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 126873085560