bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-7_CDS_annotation_glimmer3.pl_2_1 Length=49 Score E Sequences producing significant alignments: (Bits) Value gi|157128443|ref|XP_001655124.1| hypothetical protein AaeL_AAEL0... 35.0 2.3 >gi|157128443|ref|XP_001655124.1| hypothetical protein AaeL_AAEL011125 [Aedes aegypti] gi|108872613|gb|EAT36838.1| AAEL011125-PA [Aedes aegypti] Length=979 Score = 35.0 bits (79), Expect = 2.3, Method: Composition-based stats. Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query 4 YLISYQKQGSA--PVVYVASDNNLMATVNQALKESEGAPVLVSSAKTI 49 YL +Q+ S P V +SD N Q L E+E AP+L+SS +T+ Sbjct 470 YLNRFQQTKSRQRPTVAASSDPNPEEQTEQTLPETEAAPILISSERTL 517 Lambda K H a alpha 0.308 0.121 0.308 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 445096471851