bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-6_CDS_annotation_glimmer3.pl_2_6 Length=59 Score E Sequences producing significant alignments: (Bits) Value gi|645269651|ref|XP_008240095.1| PREDICTED: uncharacterized prot... 34.7 2.9 gi|678047448|gb|KFU79287.1| carotenoid oxygenase 34.3 4.0 gi|522118276|ref|WP_020629485.1| carotenoid cleavage dioxygenase 33.9 5.1 >gi|645269651|ref|XP_008240095.1| PREDICTED: uncharacterized protein LOC103338646 [Prunus mume] gi|645269653|ref|XP_008240096.1| PREDICTED: uncharacterized protein LOC103338646 [Prunus mume] Length=331 Score = 34.7 bits (78), Expect = 2.9, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 30/51 (59%), Gaps = 0/51 (0%) Query 8 FEIIWRDPKTGQFKTSEYRKKNQMSIVDARSYARRLVNIQNVLSVRFYKEM 58 FE++W++P++ +K E +K + I+ + +R LV + L V F K++ Sbjct 189 FEVLWKEPRSIIYKVGEIERKIEFLILRMKFNSRCLVEVPEYLGVNFEKQI 239 >gi|678047448|gb|KFU79287.1| carotenoid oxygenase [Amycolatopsis lurida NRRL 2430] Length=478 Score = 34.3 bits (77), Expect = 4.0, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 4/39 (10%) Query 13 RDPKTGQFKTSEY----RKKNQMSIVDARSYARRLVNIQ 47 RDP+TG+ Y K Q S++DAR ARR V+++ Sbjct 152 RDPETGELHAVSYFFGSGNKVQYSVIDARGRARRTVDVE 190 >gi|522118276|ref|WP_020629485.1| carotenoid cleavage dioxygenase [Amycolatopsis alba] Length=476 Score = 33.9 bits (76), Expect = 5.1, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 4/39 (10%) Query 13 RDPKTGQFKTSEY----RKKNQMSIVDARSYARRLVNIQ 47 RDP+TG+ Y K Q S++DA +ARR V+I+ Sbjct 151 RDPETGELHAVSYFFGWGNKVQYSVIDAEGHARRTVDIE 189 Lambda K H a alpha 0.326 0.136 0.404 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 431863444341