bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-33_CDS_annotation_glimmer3.pl_2_1 Length=174 Score E Sequences producing significant alignments: (Bits) Value gi|547226431|ref|WP_021963494.1| predicted protein 60.8 5e-08 gi|494822887|ref|WP_007558295.1| hypothetical protein 60.5 8e-08 gi|575094322|emb|CDL65709.1| unnamed protein product 55.5 3e-06 gi|496521300|ref|WP_009229583.1| hypothetical protein 50.4 2e-04 gi|490418708|ref|WP_004291031.1| hypothetical protein 49.7 3e-04 gi|575094355|emb|CDL65737.1| unnamed protein product 47.4 0.001 gi|496050828|ref|WP_008775335.1| hypothetical protein 47.0 0.002 gi|565841285|ref|WP_023924566.1| hypothetical protein 46.2 0.004 gi|658546086|ref|WP_029738781.1| hypothetical protein 41.6 0.019 gi|546189465|ref|WP_021825245.1| hypothetical protein 43.5 0.032 >gi|547226431|ref|WP_021963494.1| predicted protein [Prevotella sp. CAG:1185] gi|524103383|emb|CCY83995.1| predicted protein [Prevotella sp. CAG:1185] Length=498 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 2/58 (3%) Query 86 QFKGLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFFF 143 G L Y + RD QLF KR+RK LSK EKI Y+VSEY PKT R H+H+LFF+ Sbjct 125 NLDGYLSYTSKRDAQLFLKRVRKNLSKYSD--EKIRYYIVSEYGPKTFRAHYHVLFFY 180 >gi|494822887|ref|WP_007558295.1| hypothetical protein [Bacteroides plebeius] gi|198272100|gb|EDY96369.1| hypothetical protein BACPLE_00805 [Bacteroides plebeius DSM 17135] Length=545 Score = 60.5 bits (145), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 7/79 (9%) Query 64 MLPELAESLKKKNNTDANGAFPQFKGLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSY 123 M P+L +K+ N N +KG Y++ R+ QLF KRLRKYL K G +KI + Sbjct 96 MTPQLMNEYQKRVNYRIN-----YKGRFPYLSKRELQLFMKRLRKYLDKYEG--QKIRFF 148 Query 124 VVSEYSPKTLRPHFHILFF 142 EY P + RPHFHIL F Sbjct 149 ATGEYGPLSFRPHFHILLF 167 >gi|575094322|emb|CDL65709.1| unnamed protein product [uncultured bacterium] Length=499 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 7/96 (7%) Query 48 SPLQRFKDEYFEELVWMLPELAESLKKKNNTDANGAFPQFKGLLKYINIRDYQLFSKRLR 107 S L F +++ +++ + + K + + G GL + RD QLF KRLR Sbjct 101 SDLHNFDNDFVDKMDYYSDYVINYESKYHKSCVYG-----HGLYALLYYRDIQLFLKRLR 155 Query 108 KYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFFF 143 K++ K G EKI Y++ EY K+LRPH+H L FF Sbjct 156 KHIYKYYG--EKIRFYIIGEYGTKSLRPHWHCLLFF 189 >gi|496521300|ref|WP_009229583.1| hypothetical protein [Prevotella sp. oral taxon 317] gi|288330571|gb|EFC69155.1| hypothetical protein HMPREF0670_00478 [Prevotella sp. oral taxon 317 str. F0108] Length=569 Score = 50.4 bits (119), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 28/49 (57%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Query 97 RDYQLFSKRLRKYLSKKIGKYE--KIHSYVVSEYSPKTLRPHFHILFFF 143 +D Q F KRLR +SK GK E KI YV SEY P TLRPH+H + FF Sbjct 136 KDIQNFLKRLRFNISKLYGKAESRKIRYYVASEYGPTTLRPHYHGIIFF 184 >gi|490418708|ref|WP_004291031.1| hypothetical protein [Bacteroides eggerthii] gi|217986635|gb|EEC52969.1| hypothetical protein BACEGG_02720 [Bacteroides eggerthii DSM 20697] Length=422 Score = 49.7 bits (117), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 1/56 (2%) Query 89 GLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFFFR 144 G L Y+ D QLF KR R Y++K+ K EK+ + + EY P RPH+HIL F + Sbjct 39 GYLPYLRKFDLQLFFKRFRYYVAKRFPK-EKVRYFAIGEYGPVHFRPHYHILLFLQ 93 >gi|575094355|emb|CDL65737.1| unnamed protein product [uncultured bacterium] Length=517 Score = 47.4 bits (111), Expect = 0.001, Method: Compositional matrix adjust. Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 2/55 (4%) Query 89 GLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFFF 143 G + Y+ RD QLF KRLRK LSK K+ + + EY P RPH+H L FF Sbjct 121 GDVPYLRKRDLQLFIKRLRKNLSKYSDA--KVRYFAMGEYGPVHFRPHYHFLLFF 173 >gi|496050828|ref|WP_008775335.1| hypothetical protein [Bacteroides sp. 2_2_4] gi|229448892|gb|EEO54683.1| hypothetical protein BSCG_01608 [Bacteroides sp. 2_2_4] Length=497 Score = 47.0 bits (110), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 1/56 (2%) Query 89 GLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFFFR 144 G + Y+ D QLF KRLR Y++K+ EK+ + V EY P RPH+H+L F + Sbjct 115 GDVPYLRKTDLQLFLKRLRYYVTKQKPS-EKVRYFAVGEYGPVHFRPHYHLLLFLQ 169 >gi|565841285|ref|WP_023924566.1| hypothetical protein [Prevotella nigrescens] gi|564729906|gb|ETD29850.1| hypothetical protein HMPREF1173_00032 [Prevotella nigrescens CC14M] Length=484 Score = 46.2 bits (108), Expect = 0.004, Method: Compositional matrix adjust. Identities = 32/89 (36%), Positives = 40/89 (45%), Gaps = 5/89 (6%) Query 60 ELVWMLPELAESLKKKNNTDANGAFPQFKGLLKYINIRDYQLFSKRLRKYLSKKIGKY-- 117 E+VW L + N D + Y D F KRLR LS K+ Sbjct 81 EMVWTSNRLCDEKVIVGNYDFIKVSNSDVQAVAYCCKSDIVKFFKRLRSKLSYYFKKHHI 140 Query 118 ---EKIHSYVVSEYSPKTLRPHFHILFFF 143 EKI +V SEY PKTLRPH+H + +F Sbjct 141 ITNEKIRYFVCSEYGPKTLRPHYHAIIWF 169 >gi|658546086|ref|WP_029738781.1| hypothetical protein, partial [Elizabethkingia anophelis] Length=68 Score = 41.6 bits (96), Expect = 0.019, Method: Compositional matrix adjust. Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 7/54 (13%) Query 89 GLLKYINIRDYQLFSKRLRKYLSKKIGKYEKIHSYVVSEYSPKTLRPHFHILFF 142 GL+ ++ RD+QLF KR RK L KK KI ++V EY +T RPH+H + F Sbjct 17 GLMS-LDYRDFQLFMKRARK-LQKK-----KISYFLVGEYGSQTHRPHYHAIVF 63 >gi|546189465|ref|WP_021825245.1| hypothetical protein [Prevotella salivae] gi|544001993|gb|ERK01417.1| hypothetical protein HMPREF9145_2741 [Prevotella salivae F0493] Length=586 Score = 43.5 bits (101), Expect = 0.032, Method: Compositional matrix adjust. Identities = 24/67 (36%), Positives = 37/67 (55%), Gaps = 5/67 (7%) Query 81 NGAFPQFKGLLKYINIRDYQLFSKRLRKYLS----KKIGKYEKIHSYVVSEYSPKTLRPH 136 +G+ P FK L ++ Y L+ + YL+ KK + + ++ SEY+P T RPH Sbjct 176 DGSIP-FKEWLDDLDTETYDLYYSVYQYYLTDYEKKKESCKQSVRYFICSEYTPTTFRPH 234 Query 137 FHILFFF 143 FH LF+F Sbjct 235 FHGLFWF 241 Lambda K H a alpha 0.324 0.139 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 439831946280