bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-30_CDS_annotation_glimmer3.pl_2_4 Length=63 Score E Sequences producing significant alignments: (Bits) Value gi|566221214|gb|ETI86558.1| hypothetical protein Q612_NSC00296G0008 35.8 0.22 gi|494285675|ref|WP_007163744.1| plasmid partitioning protein ParB 34.7 3.5 >gi|566221214|gb|ETI86558.1| hypothetical protein Q612_NSC00296G0008 [Negativicoccus succinicivorans DORA_17_25] Length=74 Score = 35.8 bits (81), Expect = 0.22, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 4/45 (9%) Query 2 RRFYFHVQFTDVEGVERFRSIQFS--ARDIIQAH--NAGRKLVAL 42 RR VQ+TD +GVE+FR++ F+ A+D H AG+ L L Sbjct 10 RRLALRVQYTDDKGVEKFRNLSFAHVAQDATDEHIYAAGKALAGL 54 >gi|494285675|ref|WP_007163744.1| plasmid partitioning protein ParB [Erythrobacter sp. NAP1] gi|85689711|gb|EAQ29714.1| hypothetical protein NAP1_03040 [Erythrobacter sp. NAP1] gi|660646963|gb|KEO86761.1| plasmid partitioning protein ParB [Erythrobacter sp. JL475] Length=656 Score = 34.7 bits (78), Expect = 3.5, Method: Composition-based stats. Identities = 17/36 (47%), Positives = 20/36 (56%), Gaps = 0/36 (0%) Query 11 TDVEGVERFRSIQFSARDIIQAHNAGRKLVALLVCD 46 TDVE ERFR++ AR H R LVA L C+ Sbjct 498 TDVERFERFRALSDEARSAWLGHVVSRTLVASLACE 533 Lambda K H a alpha 0.330 0.141 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 443741444832