bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-26_CDS_annotation_glimmer3.pl_2_3 Length=120 Score E Sequences producing significant alignments: (Bits) Value gi|501981496|ref|WP_012683060.1| ribonuclease PH 39.3 0.20 gi|609714133|emb|CDN76778.1| conserved exported hypothetical pro... 36.2 3.4 gi|617637071|ref|XP_007530752.1| PREDICTED: repetin 36.2 3.5 gi|639228526|ref|WP_024564112.1| TonB-dependent receptor 36.2 3.5 gi|657610245|ref|WP_029421384.1| MlrC domain protein 35.0 7.0 >gi|501981496|ref|WP_012683060.1| ribonuclease PH [Gemmatimonas aurantiaca] gi|226226977|ref|YP_002761083.1| ribonuclease PH [Gemmatimonas aurantiaca T-27] gi|226090168|dbj|BAH38613.1| ribonuclease PH [Gemmatimonas aurantiaca T-27] Length=247 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 30/103 (29%), Positives = 49/103 (48%), Gaps = 5/103 (5%) Query 21 RAYRDRGGIGDRSASLIELIG-TERVSRRDYGYEGTFYVTEDGETYDNEYMNTHNPIRTG 79 R+ R+R +G R+ + LIG + R DY + G F + D + + T TG Sbjct 80 RSSRERQQVGGRTQEIQRLIGRSVRAMLDDYRF-GEFTIKVDCDVLQADG-GTRTAAITG 137 Query 80 --VNFYEVSNWRYNEGKEMYEPVIRRIVMIKIRFVEYQLSLDL 120 V + NW + G+ + PV RR+ I + V+ ++ LDL Sbjct 138 ACVAVQDAFNWMVSTGRIIASPVKRRVAAISVGMVDGEVRLDL 180 >gi|609714133|emb|CDN76778.1| conserved exported hypothetical protein [Elizabethkingia anophelis] gi|609715850|emb|CDN75776.1| conserved exported hypothetical protein [Elizabethkingia anophelis] Length=790 Score = 36.2 bits (82), Expect = 3.4, Method: Composition-based stats. Identities = 15/54 (28%), Positives = 28/54 (52%), Gaps = 0/54 (0%) Query 49 DYGYEGTFYVTEDGETYDNEYMNTHNPIRTGVNFYEVSNWRYNEGKEMYEPVIR 102 D+ Y ++ +D + Y+N+ N ++ I T +VS+W G + Y P I+ Sbjct 648 DFSYNENYFFGQDQQLYENKIYNLNSTISTSFTLQKVSDWTLEIGHQYYSPSIQ 701 >gi|617637071|ref|XP_007530752.1| PREDICTED: repetin [Erinaceus europaeus] Length=764 Score = 36.2 bits (82), Expect = 3.5, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 5/87 (6%) Query 8 QKNRKHTEEEQNYRAYRDRGGIGDRSASLIEL-IGTERVSRRDYGYEGTFYVTE--DGET 64 Q+ R H+ EQ +R + R G R + IE G +R SR +G+EG E D +T Sbjct 558 QQERSHSHTEQGHRDAQTRQSCGQRQSHQIEKEQGHQRQSR--HGHEGQENPCEVQDRQT 615 Query 65 YDNEYMNTHNPIRTGVNFYEVSNWRYN 91 +++E+ +H + +E +N R N Sbjct 616 HEHEHEQSHQTQNRQTHEHEENNQRQN 642 >gi|639228526|ref|WP_024564112.1| TonB-dependent receptor [Elizabethkingia anophelis] gi|675104847|gb|AIL46140.1| putative TonB-dependent receptor [Elizabethkingia anophelis NUHP1] Length=790 Score = 36.2 bits (82), Expect = 3.5, Method: Composition-based stats. Identities = 15/54 (28%), Positives = 28/54 (52%), Gaps = 0/54 (0%) Query 49 DYGYEGTFYVTEDGETYDNEYMNTHNPIRTGVNFYEVSNWRYNEGKEMYEPVIR 102 D+ Y ++ +D + Y+N+ N ++ I T +VS+W G + Y P I+ Sbjct 648 DFSYNENYFFGQDQQLYENKIYNLNSTISTSFTLQKVSDWTLEIGHQYYSPSIQ 701 >gi|657610245|ref|WP_029421384.1| MlrC domain protein [Alicyclobacillus macrosporangiidus] Length=490 Score = 35.0 bits (79), Expect = 7.0, Method: Composition-based stats. Identities = 27/78 (35%), Positives = 38/78 (49%), Gaps = 8/78 (10%) Query 28 GIGDRSASLIELIGTERVSRRDYGYEGTFYVTEDGETYDNEYMNTHNPIRTGVNFYEVSN 87 GI D +L++ I RRD GYE VT D E M + GVNFY ++ Sbjct 112 GIDDLEGTLLKAI------RRDVGYEVPIVVTLDLHGNITEQMVQEADVLLGVNFYPHTD 165 Query 88 WRYNEGKEMYEPVIRRIV 105 Y+ G+E + V +R+V Sbjct 166 -SYDRGREAID-VAKRLV 181 Lambda K H a alpha 0.317 0.137 0.405 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 438877747044