bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-24_CDS_annotation_glimmer3.pl_2_3 Length=97 Score E Sequences producing significant alignments: (Bits) Value gi|308466971|ref|XP_003095736.1| hypothetical protein CRE_10575 36.6 1.4 gi|664333012|ref|WP_030861233.1| chemotaxis protein CheY 35.4 2.6 gi|358384860|gb|EHK22457.1| hypothetical protein TRIVIDRAFT_84034 35.8 2.7 gi|119498557|ref|XP_001266036.1| SET and WW domain protein 35.4 3.9 gi|50428561|ref|YP_054407.1| replication-associated protein 35.4 4.1 gi|671612181|ref|WP_031582192.1| hypothetical protein 34.7 5.7 gi|628084408|ref|XP_007704054.1| hypothetical protein COCSADRAFT... 34.7 7.1 gi|627845823|ref|XP_007689300.1| hypothetical protein COCMIDRAFT... 34.3 7.5 gi|628194087|ref|XP_007709371.1| hypothetical protein COCCADRAFT... 34.3 7.8 gi|451994789|gb|EMD87258.1| hypothetical protein COCHEDRAFT_1113604 34.3 8.4 >gi|308466971|ref|XP_003095736.1| hypothetical protein CRE_10575 [Caenorhabditis remanei] gi|308244501|gb|EFO88453.1| hypothetical protein CRE_10575 [Caenorhabditis remanei] Length=502 Score = 36.6 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 5/58 (9%) Query 1 MLEYMIEDLPEYRSRGERIMSVLNGSGSVEVLP--GRP--DVQASDSDFRKGEDYDPP 54 ML+Y++E EYR +GE+IM L G + VLP G+ + S ++ KG+DY+ P Sbjct 59 MLDYIVETANEYRGKGEKIMR-LQFIGKLLVLPLDGKTAQTMLQSTTELDKGDDYEFP 115 >gi|664333012|ref|WP_030861233.1| chemotaxis protein CheY [Streptomyces sp. NRRL F-2747] Length=216 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 29/89 (33%), Positives = 40/89 (45%), Gaps = 9/89 (10%) Query 8 DLPEYRSRGERIMSVLNGSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDK 67 D P YR E I+S L GSG +EV+ D + + R+ LD+ R+ + Sbjct 16 DHPVYR---EGIVSALTGSGRIEVVAAVGDGRTALEAIREHAPAVALLDY------RMPE 66 Query 68 FDGLESGQGVIDDFLERQRSSSSAKSEKD 96 DGLE V D L + SA +E D Sbjct 67 LDGLEVAHAVARDELPTRVLLLSATTESD 95 >gi|358384860|gb|EHK22457.1| hypothetical protein TRIVIDRAFT_84034 [Trichoderma virens Gv29-8] Length=794 Score = 35.8 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 10/67 (15%) Query 26 SGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFD-GLESG----QGVIDD 80 S V+VLPG +V++ +FRK +DP LD D ++D D L SG + ID+ Sbjct 18 SSGVDVLPGAGNVESELRNFRKQHRWDPFLDID-----KLDNIDEALASGNAEKEAAIDE 72 Query 81 FLERQRS 87 L ++ S Sbjct 73 SLIQEDS 79 >gi|119498557|ref|XP_001266036.1| SET and WW domain protein [Neosartorya fischeri NRRL 181] gi|119414200|gb|EAW24139.1| SET and WW domain protein [Neosartorya fischeri NRRL 181] Length=967 Score = 35.4 bits (80), Expect = 3.9, Method: Compositional matrix adjust. Identities = 21/68 (31%), Positives = 39/68 (57%), Gaps = 4/68 (6%) Query 22 VLNGSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDDF 81 + NG +VE + DV+ SD + K E+ D +D DP + + D ++ G+G ++ Sbjct 800 MTNGHNTVEDV----DVKLSDGEAEKVEENDTFMDSDPQGILKRKREDEMDIGEGAAEEA 855 Query 82 LERQRSSS 89 ++RQ+SS+ Sbjct 856 MKRQKSST 863 >gi|50428561|ref|YP_054407.1| replication-associated protein [Opuntia virus X] gi|38146353|gb|AAR11547.1| replication-associated protein [Opuntia virus X] Length=1555 Score = 35.4 bits (80), Expect = 4.1, Method: Composition-based stats. Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 0/40 (0%) Query 57 FDPNSFSRIDKFDGLESGQGVIDDFLERQRSSSSAKSEKD 96 +DPNS++ +DK D L + Q DFL++QR+ + + KD Sbjct 435 WDPNSYNPLDKVDELSTEQLKAWDFLQKQRNPTQEEFHKD 474 >gi|671612181|ref|WP_031582192.1| hypothetical protein [Lachnospiraceae bacterium AC2028] Length=582 Score = 34.7 bits (78), Expect = 5.7, Method: Compositional matrix adjust. Identities = 16/73 (22%), Positives = 38/73 (52%), Gaps = 0/73 (0%) Query 23 LNGSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDDFL 82 +N +++++ P++Q ++DF+K D + P + D + +I+ +E +F+ Sbjct 507 VNDISNLQLIEAMPNIQKQNTDFKKWYDEEYPTEKDKIQYRKINYIPDMEYDYSDFKEFI 566 Query 83 ERQRSSSSAKSEK 95 E++R+ EK Sbjct 567 EKRRTLLKKAFEK 579 >gi|628084408|ref|XP_007704054.1| hypothetical protein COCSADRAFT_40358 [Bipolaris sorokiniana ND90Pr] gi|451846573|gb|EMD59882.1| hypothetical protein COCSADRAFT_40358 [Bipolaris sorokiniana ND90Pr] Length=388 Score = 34.7 bits (78), Expect = 7.1, Method: Composition-based stats. Identities = 21/56 (38%), Positives = 25/56 (45%), Gaps = 0/56 (0%) Query 25 GSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDD 80 S SV P RP DSD+ DY PPLD P S+I K + + DD Sbjct 250 ASVSVSPKPARPATNRDDSDYNAIPDYSPPLDTLPKGNSKILKAEWKGQALSLADD 305 >gi|627845823|ref|XP_007689300.1| hypothetical protein COCMIDRAFT_6491 [Bipolaris oryzae ATCC 44560] gi|576930591|gb|EUC44169.1| hypothetical protein COCMIDRAFT_6491 [Bipolaris oryzae ATCC 44560] Length=389 Score = 34.3 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 21/56 (38%), Positives = 25/56 (45%), Gaps = 0/56 (0%) Query 25 GSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDD 80 S SV P RP DSD+ DY PPLD P S+I K + + DD Sbjct 251 ASVSVSPKPARPATNRDDSDYNAIPDYSPPLDTLPKGNSKILKAEWKGQALSLADD 306 >gi|628194087|ref|XP_007709371.1| hypothetical protein COCCADRAFT_23883 [Bipolaris zeicola 26-R-13] gi|576922160|gb|EUC36291.1| hypothetical protein COCCADRAFT_23883 [Bipolaris zeicola 26-R-13] gi|578485038|gb|EUN22544.1| hypothetical protein COCVIDRAFT_41654 [Bipolaris victoriae FI3] Length=392 Score = 34.3 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 21/56 (38%), Positives = 25/56 (45%), Gaps = 0/56 (0%) Query 25 GSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDD 80 S SV P RP DSD+ DY PPLD P S+I K + + DD Sbjct 254 ASVSVSPKPARPATNRDDSDYNAIPDYSPPLDTLPKGNSKILKAEWKGQALSLADD 309 >gi|451994789|gb|EMD87258.1| hypothetical protein COCHEDRAFT_1113604 [Bipolaris maydis C5] gi|477583247|gb|ENI00347.1| hypothetical protein COCC4DRAFT_150697 [Bipolaris maydis ATCC 48331] Length=388 Score = 34.3 bits (77), Expect = 8.4, Method: Composition-based stats. Identities = 21/56 (38%), Positives = 25/56 (45%), Gaps = 0/56 (0%) Query 25 GSGSVEVLPGRPDVQASDSDFRKGEDYDPPLDFDPNSFSRIDKFDGLESGQGVIDD 80 S SV P RP DSD+ DY PPLD P S+I K + + DD Sbjct 250 ASVSVSPKPARPATNRDDSDYNAIPDYSPPLDTLPKGNSKILKAEWKGQALSLADD 305 Lambda K H a alpha 0.311 0.135 0.378 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 428386497840