bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-23_CDS_annotation_glimmer3.pl_2_5 Length=69 Score E Sequences producing significant alignments: (Bits) Value gi|669354414|gb|KFD84218.1| AAA domain protein 36.6 0.75 >gi|669354414|gb|KFD84218.1| AAA domain protein [Vibrio cholerae] Length=294 Score = 36.6 bits (83), Expect = 0.75, Method: Composition-based stats. Identities = 15/49 (31%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Query 10 YVNNEGKIIEREIPGMNTYKIAKKFAKILNDPEETKLVCVVESWKLYPN 58 ++NN+ +I++ IP NT I +++ LN P+ + + ++ SW+ Y N Sbjct 62 FMNNKWHVIDKNIPIFNT--IFEQYVDPLNAPDVSSIKNIISSWRFYDN 108 Lambda K H a alpha 0.309 0.129 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 435507561048