bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_5 Length=66 Score E Sequences producing significant alignments: (Bits) Value gi|669354414|gb|KFD84218.1| AAA domain protein 36.2 0.94 gi|657882033|ref|WP_029586455.1| hypothetical protein 32.3 8.9 >gi|669354414|gb|KFD84218.1| AAA domain protein [Vibrio cholerae] Length=294 Score = 36.2 bits (82), Expect = 0.94, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 29/47 (62%), Gaps = 2/47 (4%) Query 10 YVNNEKKMIEREIPGMNTYKIAEKFAKILNDPEETKLVCVIESWKLY 56 ++NN+ +I++ IP NT I E++ LN P+ + + +I SW+ Y Sbjct 62 FMNNKWHVIDKNIPIFNT--IFEQYVDPLNAPDVSSIKNIISSWRFY 106 >gi|657882033|ref|WP_029586455.1| hypothetical protein [Bradyrhizobium sp. URHD0069] Length=135 Score = 32.3 bits (72), Expect = 8.9, Method: Compositional matrix adjust. Identities = 21/65 (32%), Positives = 29/65 (45%), Gaps = 4/65 (6%) Query 3 ATKFTAIYVNNEKKMIEREIPGMNTYK----IAEKFAKILNDPEETKLVCVIESWKLYPK 58 AT F + V IPG T I + +KI++ P E +VC I +L Sbjct 35 ATPFPGVVVRAYSGETPSLIPGFKTVSMRDIIMQPGSKIMSHPMENAMVCHITEGELQID 94 Query 59 EDEKT 63 +DEKT Sbjct 95 QDEKT 99 Lambda K H a alpha 0.311 0.128 0.361 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 439624502940