bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-22_CDS_annotation_glimmer3.pl_2_2 Length=85 Score E Sequences producing significant alignments: (Bits) Value gi|547227295|ref|WP_021964313.1| putative uncharacterized protein 35.0 3.6 gi|505924261|ref|WP_015718361.1| 16S rRNA methyltransferase 34.3 6.4 gi|568398149|gb|ETN87716.1| 16S rRNA methyltransferase 33.9 6.8 gi|655045021|ref|WP_028493654.1| 16S rRNA methyltransferase 33.9 7.0 gi|648637244|ref|WP_026328995.1| 16S rRNA methyltransferase 33.9 7.0 gi|676387841|ref|XP_009037199.1| hypothetical protein AURANDRAFT... 33.9 8.1 >gi|547227295|ref|WP_021964313.1| putative uncharacterized protein [Prevotella sp. CAG:1185] gi|524105244|emb|CCY80613.1| putative uncharacterized protein [Prevotella sp. CAG:1185] Length=748 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 37/65 (57%), Gaps = 8/65 (12%) Query 10 DVFKVLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLCRLESN--------CGNDL 61 DVF+++ T++++ ++ KH+A T+ F TR A E+ N++ SN CGN L Sbjct 522 DVFQLMMRTKDKEIVWDLLSKHVARTQSFVTRFALEQYNRIVEGISNESLRELRHCGNAL 581 Query 62 CLQRS 66 ++S Sbjct 582 KEEQS 586 >gi|505924261|ref|WP_015718361.1| 16S rRNA methyltransferase [Thermus scotoductus] gi|320451554|ref|YP_004203650.1| 16S rRNA methyltransferase GidB [Thermus scotoductus SA-01] gi|320151723|gb|ADW23101.1| 16S rRNA methyltransferase GidB [Thermus scotoductus SA-01] Length=246 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 1/38 (3%) Query 14 VLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLC 51 VLP QEE+ ++V+ K +T ++P R E N LC Sbjct 210 VLPVAQEERN-LVVVPKEASTPARYPRRPGVPERNPLC 246 >gi|568398149|gb|ETN87716.1| 16S rRNA methyltransferase [Thermus sp. NMX2.A1] Length=242 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 1/38 (3%) Query 14 VLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLC 51 VLP QEE+ ++V+ K +T ++P R E N LC Sbjct 206 VLPVAQEERN-LVVVPKEASTPARYPRRPGVPERNPLC 242 >gi|655045021|ref|WP_028493654.1| 16S rRNA methyltransferase [Thermus antranikianii] Length=242 Score = 33.9 bits (76), Expect = 7.0, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 1/38 (3%) Query 14 VLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLC 51 VLP QEE+ ++V+ K +T K+P R +N LC Sbjct 206 VLPVVQEERN-LVVVAKEASTPAKYPRRPGVPGKNPLC 242 >gi|648637244|ref|WP_026328995.1| 16S rRNA methyltransferase [Thermus scotoductus] Length=242 Score = 33.9 bits (76), Expect = 7.0, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (58%), Gaps = 1/38 (3%) Query 14 VLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLC 51 VLP QEE+ ++V+ K +T ++P R E N LC Sbjct 206 VLPVAQEERN-LVVVPKEASTPARYPRRPGVPERNPLC 242 >gi|676387841|ref|XP_009037199.1| hypothetical protein AURANDRAFT_64331 [Aureococcus anophagefferens] gi|323451941|gb|EGB07816.1| hypothetical protein AURANDRAFT_64331 [Aureococcus anophagefferens] Length=392 Score = 33.9 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 9/63 (14%) Query 4 EFNDMKDVF---KVLPTTQEEKEYMIVIGKHLATTEKFPTREAAEEENQLCRLESNCG-N 59 E ND+ VF +V T E+ Y V GKHL T FP ++ +++N L ++ NC N Sbjct 52 ELNDL--VFGGLQVGYTPNEKTTYESVCGKHLYT---FPNQDYYDDKNNLVMMKPNCSMN 106 Query 60 DLC 62 + C Sbjct 107 EFC 109 Lambda K H a alpha 0.316 0.132 0.379 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 429741524859