bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_3 Length=87 Score E Sequences producing significant alignments: (Bits) Value gi|407004583|gb|EKE20932.1| hypothetical protein ACD_7C00426G0001 35.0 4.0 >gi|407004583|gb|EKE20932.1| hypothetical protein ACD_7C00426G0001, partial [uncultured bacterium] Length=792 Score = 35.0 bits (79), Expect = 4.0, Method: Compositional matrix adjust. Identities = 23/68 (34%), Positives = 40/68 (59%), Gaps = 3/68 (4%) Query 1 MITSTKMKRSKAMMNKTWNVRDQPRESLERQLEKKYKEIDGNYRMLRKVSNIEDAKMLVD 60 ++ T SK +NK V E L EKKYK+I +Y +++K+S +++K+L+D Sbjct 613 ILKKTFFSISKPEINKACKVFIFLLEKLFE--EKKYKQITDSYNLIKKISFDQESKILID 670 Query 61 EIWQMKSF 68 I+ +K+F Sbjct 671 SIF-IKAF 677 Lambda K H a alpha 0.313 0.125 0.345 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 443089861740