bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-19_CDS_annotation_glimmer3.pl_2_3 Length=83 Score E Sequences producing significant alignments: (Bits) Value gi|15294108|gb|AAK95231.1| envelope glycoprotein 35.8 1.5 gi|410180686|gb|AFV64156.1| envelope glycoprotein 32.3 7.9 >gi|15294108|gb|AAK95231.1| envelope glycoprotein [Human immunodeficiency virus 1] Length=203 Score = 35.8 bits (81), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 0/51 (0%) Query 4 EFKDMKECFQIRPTDESGEKWMITIGNHLATEEVFKSRKAAEMKINKTDWN 54 + KD + +RP + + I G T E+ + + A K+NKTDWN Sbjct 18 QLKDPVPIYCVRPNNNTRRSITIGPGRAFYTGEIIGNIRKAYCKLNKTDWN 68 >gi|410180686|gb|AFV64156.1| envelope glycoprotein, partial [Human immunodeficiency virus 1] Length=79 Score = 32.3 bits (72), Expect = 7.9, Method: Compositional matrix adjust. Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (7%) Query 14 IRPTDESGEKWMITIGN-HLATEEVFKSRKAAEMKINKTDW-NLVSAFFFAIKEAVEFEN 71 IRP + + + I G LATEE+ + A IN+T+W N +S ++E +FEN Sbjct 10 IRPNNNTRKGIHIGPGRVFLATEEIIGDIRKAHCNINRTEWNNTLSKIVGELRE--QFEN 67 Query 72 K 72 K Sbjct 68 K 68 Lambda K H a alpha 0.315 0.129 0.365 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 432584175213