bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-13_CDS_annotation_glimmer3.pl_2_3 Length=174 Score E Sequences producing significant alignments: (Bits) Value gi|495547522|ref|WP_008272101.1| Secreted polysaccharide polymerase 38.1 2.4 gi|504642753|ref|WP_014829855.1| hypothetical protein 36.6 9.5 gi|503720428|ref|WP_013954504.1| hypothetical protein 36.6 9.5 gi|503221868|ref|WP_013456529.1| hypothetical protein 36.6 9.5 gi|500501496|ref|WP_011949222.1| hypothetical protein 36.6 9.6 >gi|495547522|ref|WP_008272101.1| Secreted polysaccharide polymerase [Flavobacteriales bacterium ALC-1] gi|159875656|gb|EDP69716.1| Secreted polysaccharide polymerase [Flavobacteriales bacterium ALC-1] Length=405 Score = 38.1 bits (87), Expect = 2.4, Method: Compositional matrix adjust. Identities = 29/122 (24%), Positives = 52/122 (43%), Gaps = 18/122 (15%) Query 20 IYARIHKHARGELRDNRLRRPCRQPFGHVVINLRQRHFRHVLSVICQSHKITILMIIFYK 79 +YAR A G D ++ L F + I ++ KI IL+I+FY Sbjct 146 VYARELDRAEGLYGDAN-----NAALASIIAYLLFDKFFKPWNFITKASKILILLILFYS 200 Query 80 VTLLCGSVSFFYQTIGALSTVDLYKFSCIFILNHSWMLTFVKILKYSIIHKIFYLGVTAT 139 V L ST L+ F+ +F + + T ++++ + ++ +FY G+ A Sbjct 201 VFL-------------TFSTTGLFVFTIVFFITNYKFFTGIRLILFGVLIALFYAGIFAL 247 Query 140 RS 141 +S Sbjct 248 KS 249 >gi|504642753|ref|WP_014829855.1| hypothetical protein [Mycoplasma bovis] gi|392429632|ref|YP_006470677.1| hypothetical protein Mbov_0038 [Mycoplasma bovis HB0801] gi|392051041|gb|AFM51416.1| putative transmembrane protein [Mycoplasma bovis HB0801] Length=3326 Score = 36.6 bits (83), Expect = 9.5, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 0/55 (0%) Query 85 GSVSFFYQTIGALSTVDLYKFSCIFILNHSWMLTFVKILKYSIIHKIFYLGVTAT 139 GS +F+ Q I A+S ++ YKF+ F+ N SW + + +SI+ + G T Sbjct 119 GSFNFYNQYIEAVSPIEFYKFTEWFMKNVSWGPEIITLKSFSIVKGVEMAGNNIT 173 >gi|503720428|ref|WP_013954504.1| hypothetical protein [Mycoplasma bovis] gi|339320565|ref|YP_004683087.1| hypothetical protein MMB_0038 [Mycoplasma bovis Hubei-1] gi|338226690|gb|AEI89752.1| conserved hypothetical protein [Mycoplasma bovis Hubei-1] gi|640844520|gb|AIA33629.1| hypothetical protein K668_00185 [Mycoplasma bovis CQ-W70] Length=3326 Score = 36.6 bits (83), Expect = 9.5, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 0/55 (0%) Query 85 GSVSFFYQTIGALSTVDLYKFSCIFILNHSWMLTFVKILKYSIIHKIFYLGVTAT 139 GS +F+ Q I A+S ++ YKF+ F+ N SW + + +SI+ + G T Sbjct 119 GSFNFYNQYIEAVSPIEFYKFTEWFMKNVSWGPEIITLKSFSIVKGVEMAGNNIT 173 >gi|503221868|ref|WP_013456529.1| hypothetical protein [Mycoplasma bovis] gi|313678170|ref|YP_004055910.1| hypothetical protein MBOVPG45_0038 [Mycoplasma bovis PG45] gi|312950720|gb|ADR25315.1| conserved domain protein [Mycoplasma bovis PG45] Length=3326 Score = 36.6 bits (83), Expect = 9.5, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 0/55 (0%) Query 85 GSVSFFYQTIGALSTVDLYKFSCIFILNHSWMLTFVKILKYSIIHKIFYLGVTAT 139 GS +F+ Q I A+S ++ YKF+ F+ N SW + + +SI+ + G T Sbjct 119 GSFNFYNQYIEAVSPIEFYKFTEWFMKNVSWGPEIITLKSFSIVKGVEMAGNNIT 173 >gi|500501496|ref|WP_011949222.1| hypothetical protein [Mycoplasma agalactiae] gi|148377307|ref|YP_001256183.1| hypothetical protein MAG_0390 [Mycoplasma agalactiae PG2] gi|148291353|emb|CAL58736.1| Conserved hypothetical protein [Mycoplasma agalactiae PG2] Length=3329 Score = 36.6 bits (83), Expect = 9.6, Method: Composition-based stats. Identities = 18/55 (33%), Positives = 31/55 (56%), Gaps = 0/55 (0%) Query 85 GSVSFFYQTIGALSTVDLYKFSCIFILNHSWMLTFVKILKYSIIHKIFYLGVTAT 139 GS +F+ Q I A+S ++ YKF+ F+ N SW + + +SI+ + G + T Sbjct 119 GSFNFYNQYIEAVSPLEFYKFTEWFMKNVSWGPEIITLKSFSIVKGVEMTGNSIT 173 Lambda K H a alpha 0.337 0.146 0.461 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 439831946280