bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 49,011,213 sequences; 17,563,301,199 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=279 Score E Sequences producing significant alignments: (Bits) Value gi|146181502|ref|XP_001022905.2| cation channel family protein 38.9 3.8 gi|6526693|dbj|BAA88076.1| vitellogenin-2 38.5 5.3 >gi|146181502|ref|XP_001022905.2| cation channel family protein [Tetrahymena thermophila] gi|146144160|gb|EAS02660.2| polycystin cation channel protein [Tetrahymena thermophila SB210] Length=1469 Score = 38.9 bits (89), Expect = 3.8, Method: Compositional matrix adjust. Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Query 29 PFQADYSGIGSSIGNIFQYDLMQSEKSQLQGARQLSDAKAMETLSNIDWGNLTAETRNYL 88 P DYS G S NIFQYD + Q A L+ A+A++ L+N+ E NY+ Sbjct 194 PITPDYSTYGPS--NIFQYDSYNNGFVQFFSAFNLTHAQAVDMLTNLSNDQFFDEQTNYI 251 Query 89 RSTGL 93 G+ Sbjct 252 SCDGV 256 >gi|6526693|dbj|BAA88076.1| vitellogenin-2 [Plautia stali] Length=1856 Score = 38.5 bits (88), Expect = 5.3, Method: Compositional matrix adjust. Identities = 33/84 (39%), Positives = 43/84 (51%), Gaps = 11/84 (13%) Query 88 LRSTGLARAQLGYVKEQQ---EVDNMAMTGLIMRA-QRSGMLLDNEAKGILNKYLDQEQQ 143 L GLA A G+ QQ +++ +TGL A Q SG L+ +GIL Y D E Q Sbjct 9 LTFVGLAAADYGWKAGQQYTYKIEARTVTGLHQVADQYSGSLI----QGILKVYADSENQ 64 Query 144 LDLNV---KAADYYQRMSAGYLSY 164 L L V K AD QR+ G+ +Y Sbjct 65 LTLQVQDAKYADINQRLHEGWATY 88 Lambda K H a alpha 0.313 0.128 0.356 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1384219325433