bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-24_CDS_annotation_glimmer3.pl_2_4 Length=66 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_D_022_Microviridae_AG0390_hypothetical.... 61.6 3e-15 Alpavirinae_Human_feces_A_033_Microviridae_AG0382_hypothetical.... 61.2 4e-15 Alpavirinae_Human_gut_32_012_Microviridae_AG0209_hypothetical.p... 41.2 1e-07 Alpavirinae_Human_gut_31_126_Microviridae_AG0304_hypothetical.p... 41.2 1e-07 unnamed protein product 19.2 5.0 > Alpavirinae_Human_feces_D_022_Microviridae_AG0390_hypothetical.protein Length=215 Score = 61.6 bits (148), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Query 9 MEKVPFYRKKSFWTLLISILTALSVYFAASC--SRKVFYRSSGIHCDTVEVDVR 60 MEK PFYR K+FWTL+ SI+ AL+ YF SC S+KVF +GIH DTV ++ + Sbjct 24 MEKTPFYRNKAFWTLVTSIIAALAAYFTVSCSYSQKVF--RNGIHYDTVRIESK 75 > Alpavirinae_Human_feces_A_033_Microviridae_AG0382_hypothetical.protein Length=192 Score = 61.2 bits (147), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 29/52 (56%), Positives = 38/52 (73%), Gaps = 4/52 (8%) Query 9 MEKVPFYRKKSFWTLLISILTALSVYFAASCS--RKVFYRSSGIHCDTVEVD 58 MEK PFYR K+FWTL+ S++ AL+ YF SCS +KVF G+H DTV+V+ Sbjct 1 MEKTPFYRTKAFWTLVTSMIAALAAYFTVSCSYTQKVFRH--GVHHDTVKVE 50 > Alpavirinae_Human_gut_32_012_Microviridae_AG0209_hypothetical.protein Length=190 Score = 41.2 bits (95), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Query 16 RKKSFWTLLISILTALSVYFAASCSRKVFYRSSGIHCDTVEVDVR 60 + K FWTL+ +I+ AL+ +F ASC +G+H DTV + R Sbjct 9 KSKKFWTLVAAIVAALTAFFTASCQYSGTLFRTGVHNDTVRYEYR 53 > Alpavirinae_Human_gut_31_126_Microviridae_AG0304_hypothetical.protein Length=190 Score = 41.2 bits (95), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 0/45 (0%) Query 16 RKKSFWTLLISILTALSVYFAASCSRKVFYRSSGIHCDTVEVDVR 60 + K FWTL+ +I+ AL+ +F ASC +G+H DTV + R Sbjct 9 KSKKFWTLVAAIVAALTAFFTASCQYSGTLFRTGVHNDTVRYEYR 53 > unnamed protein product Length=128 Score = 19.2 bits (38), Expect = 5.0, Method: Compositional matrix adjust. Identities = 8/29 (28%), Positives = 14/29 (48%), Gaps = 0/29 (0%) Query 32 SVYFAASCSRKVFYRSSGIHCDTVEVDVR 60 S Y + ++KV + HC + D+R Sbjct 57 SGYRTPAWNKKVGGAENSYHCKGMAADIR 85 Lambda K H a alpha 0.331 0.138 0.439 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3658814