bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-16_CDS_annotation_glimmer3.pl_2_4 Length=91 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_CF7ML_001_Microviridae_AG0307_putative.VP4 26.2 0.043 Microvirus_gi|89888618|ref|YP_512378.1|_gpH_[Enterobacteria_pha... 21.6 1.5 Microvirus_gi|89888095|ref|YP_512788.1|_gpA_[Enterobacteria_pha... 21.6 1.6 Gokush_SectLung2LLL_002_Microviridae_AG0239_putative.VP4 20.8 2.7 Alpavirinae_Human_feces_C_043_Microviridae_AG0322_putative.VP1 20.0 5.9 Alpavirinae_Human_feces_D_008_Microviridae_AG098_putative.VP1 19.6 8.6 Alpavirinae_Human_feces_D_031_Microviridae_AG0425_putative.VP1 19.2 9.3 > Alpavirinae_CF7ML_001_Microviridae_AG0307_putative.VP4 Length=593 Score = 26.2 bits (56), Expect = 0.043, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 23/48 (48%), Gaps = 6/48 (13%) Query 38 KQTGRDVIPPYIVNSLEGLGHYSERVSQLGLIVIVDSIREENDFVELK 85 KQT VIPP +V+ Y + Q G + +D +R F+ LK Sbjct 342 KQTIVSVIPPCVVS------RYFPKCYQYGTLSNLDKLRVYTRFIRLK 383 > Microvirus_gi|89888618|ref|YP_512378.1|_gpH_[Enterobacteria_phage_ID2_Moscow/ID/2001] Length=335 Score = 21.6 bits (44), Expect = 1.5, Method: Composition-based stats. Identities = 7/20 (35%), Positives = 13/20 (65%), Gaps = 0/20 (0%) Query 72 VDSIREENDFVELKTQRDEE 91 +DS+R D ++TQR ++ Sbjct 254 IDSVRANTDRTHVETQRSKQ 273 > Microvirus_gi|89888095|ref|YP_512788.1|_gpA_[Enterobacteria_phage_ID18_sensu_lato] Length=556 Score = 21.6 bits (44), Expect = 1.6, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (58%), Gaps = 4/33 (12%) Query 58 HYSERVSQLGLIVIVDSIREENDFVELKTQRDE 90 H+ E VS+ L SIRE+ ++ + K +DE Sbjct 178 HWYELVSKRPL----KSIREDYNYAKAKGTKDE 206 > Gokush_SectLung2LLL_002_Microviridae_AG0239_putative.VP4 Length=294 Score = 20.8 bits (42), Expect = 2.7, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 0/27 (0%) Query 29 QKFIISVKEKQTGRDVIPPYIVNSLEG 55 +K I K+TG +IP Y S G Sbjct 180 EKAITHYVNKETGEQIIPEYSTMSRGG 206 > Alpavirinae_Human_feces_C_043_Microviridae_AG0322_putative.VP1 Length=602 Score = 20.0 bits (40), Expect = 5.9, Method: Composition-based stats. Identities = 8/28 (29%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 5 ENLIPLRRIEVTAIINALKIIKIMQKFI 32 E L + E TA+IN++ ++ ++I Sbjct 480 ETLFNEQSTEATALINSIPVLGYSPRYI 507 > Alpavirinae_Human_feces_D_008_Microviridae_AG098_putative.VP1 Length=618 Score = 19.6 bits (39), Expect = 8.6, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%), Gaps = 0/18 (0%) Query 64 SQLGLIVIVDSIREENDF 81 SQLG + IVD+ E F Sbjct 278 SQLGDVSIVDTSGSEGTF 295 > Alpavirinae_Human_feces_D_031_Microviridae_AG0425_putative.VP1 Length=614 Score = 19.2 bits (38), Expect = 9.3, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%), Gaps = 0/18 (0%) Query 64 SQLGLIVIVDSIREENDF 81 SQLG + IVD+ E F Sbjct 274 SQLGDVSIVDASGSEGTF 291 Lambda K H a alpha 0.319 0.140 0.368 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 4169376