bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: Microviridae_proteins.fasta 575 sequences; 147,441 total letters Query= Contig-14_CDS_annotation_glimmer3.pl_2_3 Length=55 Score E Sequences producing significant alignments: (Bits) Value Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.p... 21.6 0.33 Gokush_gi|393707866|ref|YP_004732988.1|_DNA_replication_initiat... 20.8 1.0 Pichovirinae_Bourget_523_Microviridae_AG0333_putative.VP1 19.2 3.5 > Alpavirinae_Human_feces_A_048_Microviridae_AG088_hypothetical.protein Length=54 Score = 21.6 bits (44), Expect = 0.33, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 30/55 (55%), Gaps = 1/55 (2%) Query 1 MKKGESTRVDMVNEDGEIEKIYLVERTDRRVIIKTVKDYkkeqienenkkqLSLW 55 M GE T + ED I K Y + R +RR+II+ D +K+ + + +QL LW Sbjct 1 MIPGECTNGFEIFEDTII-KEYNLNRKERRLIIEKTYDEQKDLLRHVLNQQLKLW 54 > Gokush_gi|393707866|ref|YP_004732988.1|_DNA_replication_initiation_protein_[Microviridae_phi-CA82] Length=353 Score = 20.8 bits (42), Expect = 1.0, Method: Compositional matrix adjust. Identities = 8/29 (28%), Positives = 17/29 (59%), Gaps = 0/29 (0%) Query 10 DMVNEDGEIEKIYLVERTDRRVIIKTVKD 38 D N DG IE++ ++ + + R + ++D Sbjct 119 DFCNSDGVIERVPVLNKAEIRHFKEILRD 147 > Pichovirinae_Bourget_523_Microviridae_AG0333_putative.VP1 Length=518 Score = 19.2 bits (38), Expect = 3.5, Method: Composition-based stats. Identities = 9/17 (53%), Positives = 12/17 (71%), Gaps = 1/17 (6%) Query 6 STRVDMVNEDGEIEKIY 22 STR+ V ED E++ IY Sbjct 482 STRIFAV-EDAEVDNIY 497 Lambda K H a alpha 0.317 0.136 0.377 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 3693648