bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-8_CDS_annotation_glimmer3.pl_2_2 Length=85 Score E Sequences producing significant alignments: (Bits) Value abv:AGABI2DRAFT223023 AGABI2DRAFT_223023; hypothetical protein 33.1 4.0 abp:AGABI1DRAFT54850 AGABI1DRAFT_54850; hypothetical protein 33.1 4.0 rbi:RB2501_14584 hypothetical protein 32.3 6.6 > abv:AGABI2DRAFT223023 AGABI2DRAFT_223023; hypothetical protein Length=370 Score = 33.1 bits (74), Expect = 4.0, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 29/51 (57%), Gaps = 7/51 (14%) Query 4 SITKYGKFRKKEWIKSAKIPFESFSEGSYALMWEGFEWDTG--CVVKGFRV 52 ++ K + R+K WIK K+ EG+YA++++G E TG VK RV Sbjct 3 AVEKANEARQKNWIKDRKV-----GEGAYAVVYQGREATTGRKVAVKKIRV 48 > abp:AGABI1DRAFT54850 AGABI1DRAFT_54850; hypothetical protein Length=370 Score = 33.1 bits (74), Expect = 4.0, Method: Composition-based stats. Identities = 19/51 (37%), Positives = 29/51 (57%), Gaps = 7/51 (14%) Query 4 SITKYGKFRKKEWIKSAKIPFESFSEGSYALMWEGFEWDTG--CVVKGFRV 52 ++ K + R+K WIK K+ EG+YA++++G E TG VK RV Sbjct 3 AVEKANEARQKNWIKDRKV-----GEGAYAVVYQGREATTGRKVAVKKIRV 48 > rbi:RB2501_14584 hypothetical protein Length=194 Score = 32.3 bits (72), Expect = 6.6, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 19/34 (56%), Gaps = 0/34 (0%) Query 8 YGKFRKKEWIKSAKIPFESFSEGSYALMWEGFEW 41 Y F ++W + + P F++ YAL+ E F+W Sbjct 81 YDHFLARDWERYSDTPLTEFADNFYALLEENFDW 114 Lambda K H a alpha 0.322 0.136 0.425 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125410680467