bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-30_CDS_annotation_glimmer3.pl_2_3 Length=290 Score E Sequences producing significant alignments: (Bits) Value tad:TRIADDRAFT_54908 hypothetical protein 38.9 1.3 bsc:COCSADRAFT_305741 hypothetical protein 36.6 6.6 > tad:TRIADDRAFT_54908 hypothetical protein Length=1005 Score = 38.9 bits (89), Expect = 1.3, Method: Composition-based stats. Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 4/85 (5%) Query 203 NQKVLQYELDRTLFDNKIKLSNAEYSTAMEALRKLRQDNDINAFR---YSM-ERVFGNSS 258 N +V QYEL DN+IKL N + + ++A + + N+I+ R Y+M ++ Sbjct 485 NNQVFQYELSVLNSDNRIKLKNVDSNGIVKATSTVSRANNIHCLRQPAYAMVTKLRMMKR 544 Query 259 DVKDVASELVKRMGLLLMRPDIKEL 283 ++++V + + R+G L+ P EL Sbjct 545 EIREVFAPVNLRLGYSLLNPQQCEL 569 > bsc:COCSADRAFT_305741 hypothetical protein Length=911 Score = 36.6 bits (83), Expect = 6.6, Method: Composition-based stats. Identities = 28/105 (27%), Positives = 50/105 (48%), Gaps = 9/105 (9%) Query 82 VYGSGVTGNSAGSAPQYQPAKIQRATMEPY--RGWNLGLSDAASMYMAMRQNKAQVENME 139 VY S + + A + PQ +P + R Y R W A S+ +R +++ + Sbjct 782 VYQSPILTDRAFAHPQTKPDLVARLMGTTYAERTW------ARSVASLVRPSRSNLRPDS 835 Query 140 AQNKLIKEQARTEGIRQGNIAMSTARSGFDLNLARE-LRNVSIDR 183 + +KE+AR +G + T R GF +++ R+ L ++ IDR Sbjct 836 LTDPALKEKARKDGQHDSLVDPGTIRYGFGIHVGRDGLEHLGIDR 880 Lambda K H a alpha 0.313 0.126 0.349 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 479831790136