bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-26_CDS_annotation_glimmer3.pl_2_4 Length=250 Score E Sequences producing significant alignments: (Bits) Value mgl:MGL_2641 hypothetical protein 42.4 0.082 pale:102897917 KLF11; Kruppel-like factor 11 37.0 > mgl:MGL_2641 hypothetical protein Length=736 Score = 42.4 bits (98), Expect = 0.082, Method: Compositional matrix adjust. Identities = 30/107 (28%), Positives = 49/107 (46%), Gaps = 6/107 (6%) Query 69 RRFSALCRRRMPMF---ETWHR-EQQHFCSEPGCGEKILYSPEFDRFGVMTLKESGKEDL 124 RRF ALC R +PM W + Q H C+EPG + + S ++R + ++ + +L Sbjct 466 RRFHALCERGIPMHYRPAVWSQFVQAHMCAEPGIYQHLYESSTYERQIALDVRRTMPANL 525 Query 125 YAFIQSHKDSVDLHKIMDRFNAGDASALQKVQGMFGDFSEMPQTYAG 171 Y F LH+++ + DA + QGM + + TY Sbjct 526 Y-FGGCGPGVPKLHRLLSAYARYDAGS-GYCQGMNNLAAVLLLTYTN 570 > pale:102897917 KLF11; Kruppel-like factor 11 Length=605 Score = 37.0 bits (84), Expect = 3.9, Method: Compositional matrix adjust. Identities = 23/72 (32%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query 39 PIFSFSASVSSIPIRVFSFRRSFMSSFPTARRFSALCRRRMPMFETWHREQQHFCSEPGC 98 P+F ++S + +P FS RR+++ SFP R+ T E+ CS GC Sbjct 474 PVF-IASSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFGCSWAGC 532 Query 99 GEKILYSPEFDR 110 G+K S E R Sbjct 533 GKKFARSDELSR 544 Lambda K H a alpha 0.320 0.132 0.411 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 363120668622