bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-24_CDS_annotation_glimmer3.pl_2_4 Length=135 Score E Sequences producing significant alignments: (Bits) Value car:cauri_0162 hypothetical protein 36.2 1.7 vni:VIBNI_A1017 putative RNA polymerase sigma-70 factor 35.4 2.1 lcm:102364394 NELFA; negative elongation factor complex member A 35.0 3.3 pca:Pcar_1683 pulM-1; type II secretion system ATPase PulM 34.3 6.2 pbi:103061029 NELFA; negative elongation factor complex member A 34.3 7.3 mev:Metev_0714 hypothetical protein 33.9 7.7 > car:cauri_0162 hypothetical protein Length=1221 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 36/71 (51%), Gaps = 3/71 (4%) Query 13 SSVSGSDSIISVLISNYPLANGGYLVSFGHDEPDGSFKNYDPVYSLDFESSKL--SKFLE 70 +S SD+++S ++N P +GG FG D PDG+ P SL + + +F E Sbjct 310 ASTKASDNLVSYALTNTPAGDGGRRF-FGWDRPDGTPWGRLPWGSLGYAQVSMGRDRFAE 368 Query 71 FSSIFLPRGCY 81 +SS L R + Sbjct 369 YSSQRLARSAF 379 > vni:VIBNI_A1017 putative RNA polymerase sigma-70 factor Length=220 Score = 35.4 bits (80), Expect = 2.1, Method: Compositional matrix adjust. Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 17/127 (13%) Query 16 SGSDSIISVLISNYPL---ANGGYLVSFGHDEPDGS---FKNYDPVYS------LDFESS 63 +G S ++V+ N L L FG DEP S F +PV + L+ E Sbjct 73 TGYSSWLTVITRNVALNRLRTDQRLEFFGDDEPVSSCPTFSVSEPVMNQNILQLLEKEID 132 Query 64 KLSKFLEFSSIFLPRGCYYLPEMELAGFIRSLSSDVSFFEMKLLPASAQLQGLLLVKVDE 123 +L + + ++F+ R + +E A SL DV+ + + A QLQ L+ ++ Sbjct 133 QLP--VMYRTVFVMRSVQGMTSLETAD---SLGLDVNVIKTRYRRARLQLQSQLIAHMER 187 Query 124 ESLSKYE 130 ES+S YE Sbjct 188 ESMSLYE 194 > lcm:102364394 NELFA; negative elongation factor complex member A Length=394 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 0/54 (0%) Query 72 SSIFLPRGCYYLPEMELAGFIRSLSSDVSFFEMKLLPASAQLQGLLLVKVDEES 125 +S LP C YL + L + L+ V F++K P SA L+ LL K E + Sbjct 9 ASAMLPLECQYLNKNALTTLVGPLTPPVKHFQLKRKPKSATLRAELLQKSTETA 62 > pca:Pcar_1683 pulM-1; type II secretion system ATPase PulM Length=295 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 17/75 (23%) Query 73 SIFLPRGCYYLPEMELAGFIRSL--SSDVSFFEM-KLLPASAQLQ--------------G 115 ++ LP C Y+ M++AGF RS S +V +++ KLLP A L Sbjct 78 ALSLPDRCGYVMTMDVAGFTRSRKESREVVAWQLRKLLPGIADLHFDYQVLKRTGGGKAH 137 Query 116 LLLVKVDEESLSKYE 130 LL+V +++++L +YE Sbjct 138 LLVVAMEKQALDRYE 152 > pbi:103061029 NELFA; negative elongation factor complex member A Length=529 Score = 34.3 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 0/54 (0%) Query 72 SSIFLPRGCYYLPEMELAGFIRSLSSDVSFFEMKLLPASAQLQGLLLVKVDEES 125 SS+ LP C YL + L L+ V F++K P SA L+ LL K E + Sbjct 144 SSVMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETA 197 > mev:Metev_0714 hypothetical protein Length=490 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 15/47 (32%), Positives = 32/47 (68%), Gaps = 0/47 (0%) Query 86 MELAGFIRSLSSDVSFFEMKLLPASAQLQGLLLVKVDEESLSKYEQE 132 ME+ I+++++D++ F+ ++L + +Q +L KVD++ L+K E E Sbjct 352 MEMDEKIQNMNNDLTSFKQEILESLENIQSVLENKVDDDKLTKIEDE 398 Lambda K H a alpha 0.313 0.133 0.364 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 125245300132