bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-24_CDS_annotation_glimmer3.pl_2_1 Length=647 Score E Sequences producing significant alignments: (Bits) Value mze:101463751 epsin-3-like 38.9 4.0 shg:Sph21_1021 FAD dependent oxidoreductase 38.1 6.8 > mze:101463751 epsin-3-like Length=577 Score = 38.9 bits (89), Expect = 4.0, Method: Compositional matrix adjust. Identities = 26/88 (30%), Positives = 43/88 (49%), Gaps = 3/88 (3%) Query 275 FVEILRSDLFNEDT-IAASPDFTNLVQLFPQGINCRVPAHPYDVQEPKVDWNN-GTGTDV 332 F++ + L N D+ I +P N F G+N P++P+ +PK+ N GTG+ + Sbjct 450 FLDPSAASLVNLDSLIPGNPSAKN-KNPFLSGLNAPSPSNPFQADQPKLSLNQMGTGSAL 508 Query 333 NIPSKVYFSATLNVPFLAAHPMAVCPSS 360 P + ++P +HP A PSS Sbjct 509 TAPHATSLPYSASLPLPTSHPGASIPSS 536 > shg:Sph21_1021 FAD dependent oxidoreductase Length=581 Score = 38.1 bits (87), Expect = 6.8, Method: Compositional matrix adjust. Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 10/87 (11%) Query 418 SKIEHVDRPKLLFSSSVMVNSQVVLNQAGQSGFEGGESAALGQMGGSISFNTVLGR---- 473 +K EH+ + +++F + +NS ++L + S F G G MG I+F+ GR Sbjct 302 TKREHLYKARIIFVNGATLNSNLILLNSKSSKFPNGLGNLNGLMGTHIAFHNYRGRITAS 361 Query 474 ----EQTYYF-KEPGYIFDMMTIRPVY 495 E YYF + P +F M + R VY Sbjct 362 IDGFEDQYYFGRRPTQVF-MPSFRNVY 387 Lambda K H a alpha 0.320 0.136 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1524475050873