bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-21_CDS_annotation_glimmer3.pl_2_5 Length=50 Score E Sequences producing significant alignments: (Bits) Value bxy:BXY_06590 Domain of unknown function (DUF1735) 32.3 4.0 cin:100184493 adipocyte plasma membrane-associated protein-like 31.6 7.2 > bxy:BXY_06590 Domain of unknown function (DUF1735). Length=377 Score = 32.3 bits (72), Expect = 4.0, Method: Composition-based stats. Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 0/30 (0%) Query 1 VSAVVAALSAFFLTSCSTSHYVAQSVSSFV 30 +S+++ ALSAFFL C + Y AQS S ++ Sbjct 6 LSSLMIALSAFFLIGCENAEYKAQSNSLYI 35 > cin:100184493 adipocyte plasma membrane-associated protein-like Length=297 Score = 31.6 bits (70), Expect = 7.2, Method: Composition-based stats. Identities = 11/41 (27%), Positives = 25/41 (61%), Gaps = 0/41 (0%) Query 4 VVAALSAFFLTSCSTSHYVAQSVSSFVQGDTTTTIIKYEQV 44 + A + + T CST + + + ++ F++G T+ +IKY+ + Sbjct 200 ITADGTTVYFTDCSTKYTLPELLTQFLEGSCTSRLIKYDML 240 Lambda K H a alpha 0.317 0.123 0.321 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 129449922336