bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-1_CDS_annotation_glimmer3.pl_2_4 Length=591 Score E Sequences producing significant alignments: (Bits) Value mdo:100033212 BUB1; BUB1 mitotic checkpoint serine/threonine k... 40.0 1.6 pti:PHATRDRAFT_44427 hypothetical protein 37.4 7.1 > mdo:100033212 BUB1; BUB1 mitotic checkpoint serine/threonine kinase Length=1127 Score = 40.0 bits (92), Expect = 1.6, Method: Compositional matrix adjust. Identities = 33/115 (29%), Positives = 53/115 (46%), Gaps = 7/115 (6%) Query 137 VGPGSLADYMGEAPGSIVTGVIDLTPYIGYIDTYYNY-----YLNQQYSLAPTSLAGTAS 191 +G GS A Y+ A + G + + +++ N L+QQYSL L GT Sbjct 94 IGIGSSALYLAWAQHLEIQGDLQRANAV-FLEGIQNKAEPIEILHQQYSLFQNRLTGTCL 152 Query 192 DSAMEYPYYLEVSELENYLRTIKTTP-NTSPAVRRDKTASYSTNVDTALNAINSE 245 + +E P L S++ N + TI+T P N PA + V ++ N+I S+ Sbjct 153 PAQVEAPEPLRNSQIVNQMNTIRTLPGNADPACPPKSQGPLPSAVQSSTNSIESK 207 > pti:PHATRDRAFT_44427 hypothetical protein Length=311 Score = 37.4 bits (85), Expect = 7.1, Method: Compositional matrix adjust. Identities = 30/101 (30%), Positives = 42/101 (42%), Gaps = 14/101 (14%) Query 470 EPAWSELMTAVSKPHGRLC----NDLDYWVLSRDYGRNLASVMDTPAYSDFIKAAGTY-- 523 + WS+L TA+ KP +L D+D+W +S L S S GTY Sbjct 157 QKVWSKLQTALDKPLRKLGLVSGEDIDHWDMSERRFNVLVSATLKEKASGQSFCIGTYHM 216 Query 524 --------VDELSLQRLTAFLKRIYVSPSSCPYILCGDFNY 556 V + ++R+ S S PYIL GDFN+ Sbjct 217 PCAFYAPMVMTIHTDLAARHVQRLAESHGSIPYILAGDFNF 257 Lambda K H a alpha 0.318 0.134 0.396 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 1354074645985