bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-19_CDS_annotation_glimmer3.pl_2_4 Length=400 Score E Sequences producing significant alignments: (Bits) Value clp:CPK_ORF00729 hypothetical protein 41.2 0.070 tsc:TSC_c05760 leucine-, isoleucine-, valine-, threonine-, and... 42.0 0.16 ttj:TTHA0451 branched-chain amino acid ABC transporter substra... 41.6 0.22 tth:TTC0082 leucine-, isoleucine-, valine-, threonine-, and al... 41.2 0.31 ttl:TtJL18_1630 branched-chain amino acid ABC transporter subs... 40.8 0.45 cpt:CpB0227 hypothetical protein 38.5 0.51 cpj:CPj0222 hypothetical protein 38.5 0.51 cpa:CP0543 hypothetical protein 38.5 0.51 cpn:CPn0222 hypothetical protein 38.5 0.51 pvu:PHAVU_001G149600g hypothetical protein 40.4 0.69 gmx:100793183 mRNA-capping enzyme-like 38.5 2.7 afo:Afer_0101 phosphoenolpyruvate carboxylase (EC:4.1.1.31) 38.5 3.0 tts:Ththe16_0451 leucine-, isoleucine-, valine-, threonine-, a... 37.4 5.1 ndi:NDAI_0C04630 NDAI0C04630; hypothetical protein 37.4 8.2 > clp:CPK_ORF00729 hypothetical protein Length=121 Score = 41.2 bits (95), Expect = 0.070, Method: Compositional matrix adjust. Identities = 22/49 (45%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Query 156 GYLNYRDMQLFFKRLNQNIRSVTNEKIYYYVVGEYGPTTFRPHFHILLF 204 G L +QLF KRL I + KI Y+ GEYG RPH+H+L+F Sbjct 68 GSLVKLHLQLFLKRLRDRI---SPHKIRYFGCGEYGTKLQRPHYHLLIF 113 > tsc:TSC_c05760 leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein Length=398 Score = 42.0 bits (97), Expect = 0.16, Method: Compositional matrix adjust. Identities = 29/89 (33%), Positives = 40/89 (45%), Gaps = 16/89 (18%) Query 144 RIYNRPYMENLIGYLNYRDMQLF-------FKRLNQNIRSVTNEKIYYYVVGEYGPTTFR 196 R Y RP EN I +NY + L +R + + VTNE +Y +VG GP F+ Sbjct 286 RKYGRP--ENFIESVNYTNGMLAAAIAVEAIRRAQERFKRVTNETVYQALVGMNGPNAFK 343 Query 197 PHFHILLFHDSKELRQSIRQFVSKSWRFG 225 P F + +Q I +KS R G Sbjct 344 PGFAV-------STKQGIEIDFTKSERTG 365 > ttj:TTHA0451 branched-chain amino acid ABC transporter substrate-binding protein Length=407 Score = 41.6 bits (96), Expect = 0.22, Method: Compositional matrix adjust. Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 9/65 (14%) Query 144 RIYNRPYMENLIGYLNYRDMQLF-------FKRLNQNIRSVTNEKIYYYVVGEYGPTTFR 196 R Y RP EN I +NY + L +R + + +TNE +Y +VG GP F+ Sbjct 295 RKYGRP--ENFIESVNYTNGMLVASIAVEAIRRAQERFKRITNETVYQAIVGMNGPNAFK 352 Query 197 PHFHI 201 P F + Sbjct 353 PGFAV 357 > tth:TTC0082 leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein Length=398 Score = 41.2 bits (95), Expect = 0.31, Method: Compositional matrix adjust. Identities = 22/65 (34%), Positives = 32/65 (49%), Gaps = 9/65 (14%) Query 144 RIYNRPYMENLIGYLNYRDMQLF-------FKRLNQNIRSVTNEKIYYYVVGEYGPTTFR 196 R Y RP EN I +NY + L +R + + +TNE +Y +VG GP F+ Sbjct 286 RKYGRP--ENFIESVNYTNGMLAAAIAVEAIRRAQERFKRITNETVYQAIVGMNGPNAFK 343 Query 197 PHFHI 201 P F + Sbjct 344 PGFAV 348 > ttl:TtJL18_1630 branched-chain amino acid ABC transporter substrate-binding protein Length=398 Score = 40.8 bits (94), Expect = 0.45, Method: Compositional matrix adjust. Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 9/65 (14%) Query 144 RIYNRPYMENLIGYLNYRDMQLF-------FKRLNQNIRSVTNEKIYYYVVGEYGPTTFR 196 R Y RP EN I +NY + L +R + + +TNE +Y ++G GP F+ Sbjct 286 RKYGRP--ENFIESVNYTNGMLAAAIAVEAIRRAQERFKRITNETVYQAIIGMNGPNAFK 343 Query 197 PHFHI 201 P F + Sbjct 344 PGFAV 348 > cpt:CpB0227 hypothetical protein Length=113 Score = 38.5 bits (88), Expect = 0.51, Method: Compositional matrix adjust. Identities = 21/48 (44%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query 156 GYLNYRDMQLFFKRLNQNIRSVTNEKIYYYVVGEYGPTTFRPHFHILL 203 G L +QLF KRL + I + KI Y+ G YG RPH+H+LL Sbjct 68 GSLVKLHLQLFLKRLRKMI---SPHKIRYFECGAYGTKLQRPHYHLLL 112 > cpj:CPj0222 hypothetical protein Length=113 Score = 38.5 bits (88), Expect = 0.51, Method: Compositional matrix adjust. Identities = 21/48 (44%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query 156 GYLNYRDMQLFFKRLNQNIRSVTNEKIYYYVVGEYGPTTFRPHFHILL 203 G L +QLF KRL + I + KI Y+ G YG RPH+H+LL Sbjct 68 GSLVKLHLQLFLKRLRKMI---SPHKIRYFECGAYGTKLQRPHYHLLL 112 > cpa:CP0543 hypothetical protein Length=113 Score = 38.5 bits (88), Expect = 0.51, Method: Compositional matrix adjust. Identities = 21/48 (44%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query 156 GYLNYRDMQLFFKRLNQNIRSVTNEKIYYYVVGEYGPTTFRPHFHILL 203 G L +QLF KRL + I + KI Y+ G YG RPH+H+LL Sbjct 68 GSLVKLHLQLFLKRLRKMI---SPHKIRYFECGAYGTKLQRPHYHLLL 112 > cpn:CPn0222 hypothetical protein Length=113 Score = 38.5 bits (88), Expect = 0.51, Method: Compositional matrix adjust. Identities = 21/48 (44%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query 156 GYLNYRDMQLFFKRLNQNIRSVTNEKIYYYVVGEYGPTTFRPHFHILL 203 G L +QLF KRL + I + KI Y+ G YG RPH+H+LL Sbjct 68 GSLVKLHLQLFLKRLRKMI---SPHKIRYFECGAYGTKLQRPHYHLLL 112 > pvu:PHAVU_001G149600g hypothetical protein Length=679 Score = 40.4 bits (93), Expect = 0.69, Method: Compositional matrix adjust. Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 6/74 (8%) Query 62 ITLTYSTEYLPVGEFYKGASGEVRFRCLPRDFVYSYKTVQGYNRNISFNDEYFDFDTQLS 121 I LT +T Y P+ ++ K G V+ RC RD V ++V+ F DE DF +Q + Sbjct 145 IDLTNTTRYYPLSDWTKEGIGHVKIRCKGRDAVPDDESVK------QFCDEVQDFCSQRT 198 Query 122 WESAQLLQKKTHLH 135 E +L TH H Sbjct 199 NEKKYILVHCTHGH 212 > gmx:100793183 mRNA-capping enzyme-like Length=645 Score = 38.5 bits (88), Expect = 2.7, Method: Compositional matrix adjust. Identities = 25/74 (34%), Positives = 36/74 (49%), Gaps = 6/74 (8%) Query 62 ITLTYSTEYLPVGEFYKGASGEVRFRCLPRDFVYSYKTVQGYNRNISFNDEYFDFDTQLS 121 I LT +T Y PV ++ K G V+ RC RD V ++V+ F D+ DF +Q + Sbjct 100 IDLTNTTRYYPVSDWTKEGIGHVKIRCTGRDAVPDDESVK------FFCDKVLDFCSQRT 153 Query 122 WESAQLLQKKTHLH 135 +L TH H Sbjct 154 NTKKYILVHCTHGH 167 > afo:Afer_0101 phosphoenolpyruvate carboxylase (EC:4.1.1.31) Length=772 Score = 38.5 bits (88), Expect = 3.0, Method: Compositional matrix adjust. Identities = 23/68 (34%), Positives = 30/68 (44%), Gaps = 0/68 (0%) Query 221 SWRFGDTDTQPVWSSASCYVAGYVNSTACLPDFYKNFSHIKPFGRFSMHFAESAFNEVFK 280 SW GD D P+ ++ A N+TACL F +K SMHFA + V Sbjct 126 SWIGGDRDGNPLVTAEVTKAAFVANATACLEAFRSRLDAVKRRLTHSMHFAAVSDAIVES 185 Query 281 PQEDEEIF 288 + DE F Sbjct 186 IRNDEHDF 193 > tts:Ththe16_0451 leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein Length=398 Score = 37.4 bits (85), Expect = 5.1, Method: Compositional matrix adjust. Identities = 20/65 (31%), Positives = 31/65 (48%), Gaps = 9/65 (14%) Query 144 RIYNRPYMENLIGYLNYRDMQLF-------FKRLNQNIRSVTNEKIYYYVVGEYGPTTFR 196 R Y RP EN I +NY + L +R + + +TNE +Y ++G GP F+ Sbjct 286 RKYGRP--ENFIESVNYTNGMLAAAIAVEAIRRAQERFKRITNETVYQAIIGMNGPNAFK 343 Query 197 PHFHI 201 F + Sbjct 344 SGFAV 348 > ndi:NDAI_0C04630 NDAI0C04630; hypothetical protein Length=3755 Score = 37.4 bits (85), Expect = 8.2, Method: Compositional matrix adjust. Identities = 43/137 (31%), Positives = 63/137 (46%), Gaps = 20/137 (15%) Query 262 PFGRFSMHFAESAFNEVFKPQEDEEIFSLFYDGRMLELNGKPTLVRPKRSHINRL-YPRL 320 P S+ + NE FK DE++F L +L ++G + NRL +PR Sbjct 3230 PLLALSLESLVAQINERFKNNTDEDLFRLI---NVLLIDGT--------FNYNRLPFPRN 3278 Query 321 NKSKHASVDDDIRVATALSNIPHVLAKFG--FIDEVTDFEM-SKRIYYLIRRYLEIDHTL 377 N +S +++ + PH+ KF FIDE DFE KR+ Y RR +++ L Sbjct 3279 NPPLPSSTANNLARLSETLLAPHIRPKFNADFIDEKPDFETYIKRLRYWRRR---LENKL 3335 Query 378 KYAP--EQLRLIYNYLS 392 AP E L I +LS Sbjct 3336 DRAPHVESLEKICPHLS 3352 Lambda K H a alpha 0.325 0.140 0.435 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 799755168114