bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: all_orgs 14,240,465 sequences; 5,121,972,263 total letters Query= Contig-10_CDS_annotation_glimmer3.pl_2_1 Length=224 Score E Sequences producing significant alignments: (Bits) Value fjo:Fjoh_3059 ATPase central domain-containing protein 37.0 2.7 roa:Pd630_LPD03873 Uncharacterized protein 35.8 7.0 > fjo:Fjoh_3059 ATPase central domain-containing protein Length=363 Score = 37.0 bits (84), Expect = 2.7, Method: Compositional matrix adjust. Identities = 20/69 (29%), Positives = 38/69 (55%), Gaps = 5/69 (7%) Query 36 LENMKKYISTLYQNTDPYTSVRISISYYSRTRTGSPRILAELLIRAGNLVVVIGLPREAT 95 L +K+ I++L QN D ++S I I+ T P +L + + R N V+ +G+P+E Sbjct 198 LGELKRVINSLLQNIDSFSSSNILIA-----ATNHPELLDKAIWRRFNHVIEVGMPKENE 252 Query 96 LNRTLRAML 104 ++ L+ + Sbjct 253 ISELLKEFV 261 > roa:Pd630_LPD03873 Uncharacterized protein Length=859 Score = 35.8 bits (81), Expect = 7.0, Method: Composition-based stats. Identities = 41/155 (26%), Positives = 62/155 (40%), Gaps = 34/155 (22%) Query 44 STLYQNTDPYT----------SVRISISYYSRTRTGSPRILAELLIRAGNLVVVIGLPRE 93 STL + TDP T + S+ Y R R+ P +AELL+ + PR Sbjct 703 STLRRRTDPATERAVIESLLVATESSVVYRRRNRSIRPAAVAELLL------FDVKNPR- 755 Query 94 ATLNRTLRAMLIHLVAFPIT-----LNRMIELNRILVSRTDLQHHAFLTPRKPLEIVFPD 148 +L L A+ +L A P R++E V R D PL + D Sbjct 756 -SLAFQLEALRANLAALPDASGASRAERLVEDMVNTVRRVD-----------PLRLESVD 803 Query 149 RSKRPRSLHSLMESLASLMENFSQSALPGRLSIPA 183 + + L L ++ +L+ S L G+LS+P Sbjct 804 ANGSRKELGELTTTMRALLSELSDVMLKGQLSLPG 838 Lambda K H a alpha 0.326 0.139 0.392 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 289237495770