bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-45_CDS_annotation_glimmer3.pl_2_1 Length=188 Score E Sequences producing significant alignments: (Bits) Value 469590.BSCG_01608 55.8 9e-07 > 469590.BSCG_01608 Length=497 Score = 55.8 bits (133), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 25/65 (38%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Query 13 FTECLRPQRIVNPYSHDVIFAPCGRCKSCIMNKSNFATAYAMNMATH-FKYCYFVTLTYK 71 F +CL P+RI+NPY+ + + PCG C++C + K N A+ ++ ++ K+ F+TLTY Sbjct 6 FCKCLHPKRIMNPYTKESMVVPCGHCQACTLAK-NSRYAFQCDLESYTAKHTLFITLTYA 64 Query 72 DIFLP 76 + F+P Sbjct 65 NRFIP 69 Lambda K H a alpha 0.325 0.140 0.427 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 180342463020