bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-34_CDS_annotation_glimmer3.pl_2_3 Length=107 Score E Sequences producing significant alignments: (Bits) Value 521000.PROVRETT_08369 36.2 0.43 > 521000.PROVRETT_08369 Length=163 Score = 36.2 bits (82), Expect = 0.43, Method: Compositional matrix adjust. Identities = 28/94 (30%), Positives = 47/94 (50%), Gaps = 7/94 (7%) Query 8 DYKSVECNFDVRKDFERTKPN-------LGLTPQQVADMAKRGIPVSPMNVNFIDVNGDA 60 D+K+VE +F++ E K L L MAKRGI + +NV V+ Sbjct 31 DFKNVEASFELNDKNESVKITSESDFQVLQLVDILREKMAKRGIDGAVLNVPEDIVHSGK 90 Query 61 SWNIEPQFRRDMDMATAWEMEKASQRKALQVLRQ 94 ++++E F++ +D ATA ++ K + L+V Q Sbjct 91 TYSVEVTFKQGIDAATAKKIVKLIKDSKLKVQAQ 124 Lambda K H a alpha 0.316 0.131 0.393 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127901841280