bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-31_CDS_annotation_glimmer3.pl_2_4 Length=66 Score E Sequences producing significant alignments: (Bits) Value 467661.RKLH11_2534 32.0 8.6 > 467661.RKLH11_2534 Length=415 Score = 32.0 bits (71), Expect = 8.6, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 4/51 (8%) Query 6 EKTIPAVKPCDYFVVSVQKSPSVPPQHVVCTTSVSLG----KTVGSILDTD 52 E IPA++PC ++ +P +P H++C G +TV L+ D Sbjct 355 EGIIPALEPCHALAHVMKIAPELPKDHLICMNMCGRGDKDVQTVARYLNFD 405 Lambda K H a alpha 0.317 0.133 0.394 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127325160200