bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.30+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggnogv4.proteins.all.fa 14,875,530 sequences; 5,112,597,290 total letters Query= Contig-28_CDS_annotation_glimmer3.pl_2_4 Length=126 Score E Sequences producing significant alignments: (Bits) Value 745277.Rahaq2_0091 37.4 0.41 > 745277.Rahaq2_0091 Length=268 Score = 37.4 bits (85), Expect = 0.41, Method: Compositional matrix adjust. Identities = 15/41 (37%), Positives = 24/41 (59%), Gaps = 0/41 (0%) Query 28 KPGIGRNYYDNHPDLYKYEYINVSTAKGGRKFRPPKYFDRI 68 KP GR +YD DL K + + ++ + GRKF+ P F+ + Sbjct 78 KPQSGRVFYDQRTDLTKLDPVQIAQSGIGRKFQKPTVFEAL 118 Lambda K H a alpha 0.319 0.136 0.397 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 127297650020